KEGG   Ursus maritimus (polar bear): 103679330Help
Entry
103679330         CDS       T03271                                 

Gene name
LTB4R
Definition
(RefSeq) leukotriene B4 receptor
  KO
K04296  leukotriene B4 receptor 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103679330 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:umr04030]
    103679330 (LTB4R)
G protein-coupled receptors [BR:umr04030]
 Rhodopsin family
  Lipid
   Leukotriene
    103679330 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 103679330
NCBI-ProteinID: XP_008707064
UniProt: A0A384DJV8
Position
Un
AA seq 249 aa AA seqDB search
MFIIPLTIVILSVALAVGLPGNGFVVWSILVKMRKRSVTALLVLNLALADLFVLLTAPFF
LHSVARGTWVFGLAGCRLSHYTCGVSMYASVLLITAMSLDRSLAVALPFVSQKVRTKAVA
WWVLASIWVMSLLLAIPVILYRTVTLTPNNQTLQCFPKYSSERVKAFHLLFEAVTGFLLP
FLVVVASYSDIRRRLQARRALRVILRTTQGYRPLKELTEEDHPCGLINSRLPESADVLST
LSTAVGPLP
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcattccgttgactattgtcatactgtcagtggcgctggccgtggggcttcct
ggcaacggctttgtggtgtggagtatcctggtaaagatgcggaagcgctctgtcactgcc
ttgctggtgctgaacctggccctggcggacttgttcgtattgcttaccgccccctttttc
ctccactctgtggcgcgaggcacctgggtgttcggactggcgggctgccgcctgtctcac
tatacctgtggagtcagcatgtacgccagcgtcctgctgatcaccgccatgagtctggac
cgctcgctggcggtggccctcccctttgtgtcccagaaggttcgtaccaaggccgttgcc
tggtgggtgctagcaagcatctgggtgatgtcccttctgctggccattcccgtcatcttg
taccgcaccgtgaccttgacaccgaacaaccagaccctgcagtgcttcccgaagtactcc
agcgaacgcgtcaaggcgttccatctgctcttcgaggccgtcaccggcttcctgctgccc
ttcctggtggtggtcgccagctattcggacatcaggcgcaggctgcaggcccggcgtgct
ctgcgggtcatacttagaacaacacagggctacagacccctgaaggagctgaccgaggaa
gaccacccatgtgggcttatcaactccagactccctgaatcagcagatgttctgagtaca
cttagcactgctgtgggacctctaccctga

DBGET integrated database retrieval system