KEGG   Ursus maritimus (polar bear): 103679331
Entry
103679331         CDS       T03271                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr01100  Metabolic pathways
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04727  GABAergic synapse
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05032  Morphine addiction
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103679331 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103679331 (ADCY4)
   04371 Apelin signaling pathway
    103679331 (ADCY4)
   04020 Calcium signaling pathway
    103679331 (ADCY4)
   04072 Phospholipase D signaling pathway
    103679331 (ADCY4)
   04024 cAMP signaling pathway
    103679331 (ADCY4)
   04022 cGMP-PKG signaling pathway
    103679331 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103679331 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103679331 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103679331 (ADCY4)
   04062 Chemokine signaling pathway
    103679331 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    103679331 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    103679331 (ADCY4)
   04912 GnRH signaling pathway
    103679331 (ADCY4)
   04913 Ovarian steroidogenesis
    103679331 (ADCY4)
   04915 Estrogen signaling pathway
    103679331 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    103679331 (ADCY4)
   04921 Oxytocin signaling pathway
    103679331 (ADCY4)
   04926 Relaxin signaling pathway
    103679331 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    103679331 (ADCY4)
   04918 Thyroid hormone synthesis
    103679331 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    103679331 (ADCY4)
   04916 Melanogenesis
    103679331 (ADCY4)
   04925 Aldosterone synthesis and secretion
    103679331 (ADCY4)
   04927 Cortisol synthesis and secretion
    103679331 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103679331 (ADCY4)
   04270 Vascular smooth muscle contraction
    103679331 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    103679331 (ADCY4)
   04971 Gastric acid secretion
    103679331 (ADCY4)
   04972 Pancreatic secretion
    103679331 (ADCY4)
   04976 Bile secretion
    103679331 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103679331 (ADCY4)
   04727 GABAergic synapse
    103679331 (ADCY4)
   04725 Cholinergic synapse
    103679331 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    103679331 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    103679331 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    103679331 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    103679331 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    103679331 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103679331 (ADCY4)
   04714 Thermogenesis
    103679331 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679331 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    103679331 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    103679331 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103679331 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679331 (ADCY4)
   05163 Human cytomegalovirus infection
    103679331 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103679331 (ADCY4)
Enzymes [BR:umr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103679331 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 103679331
NCBI-ProteinID: XP_008707065
UniProt: A0A384DJU5
Position
Un
AA seq 1074 aa
LFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLAMLAVASASGRDLASDRGFLT
TVLCALGGFSLLLGLASREQRLQRWTRPLSVLVWAALLGLGHGFLFTGGLVSAWDQVSFF
LFVIFTVYAMLPLGMRDAAAGGLASSLSHLLALGLYLGPQRDSRPALLPQLAANAVLFLC
GNVAGAYHKALMERALRATFREALRSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEI
MARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFG
KFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDI
NMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGVYA
VEDASMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPQMRPSLLMTRYLE
SWGAAKPFAHLSHLESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDEDLDTGDAKFFQ
VIEQLNSQKQWKQSKDFNPLTLYFREKELEKEYRLSALPAFKYYAACTFLVFFSNFIIQM
LVANRPPALAITYSITFLLFLLLLFVCFSEHLTKCVLKGPKMLHWLPALSGLVATRPGLR
VALGTATILLVFVMAITSLFFLPAATNCPSRASNVSSVASNVSWELPGSLPLISVPYSMH
CCVLGFLSCSLFLHMSFELKLLLLLLWLGVSCSLFLHSHAWLSDCLIARLYPDPLDSRPG
VLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLE
NVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLN
EIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATPGQDAQQDAERSCSHLGTMVEFA
VALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVVGAQKPQYDIWGNTVNVASRMESTGVL
GKIQVTEETARVLQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3225 nt   +upstreamnt  +downstreamnt
ctcttcagtccccggccgccccccagcgaagacctcttctacgagacctactacagcctg
agccagcagtacccactgctgcttctgctgctggtgattgtgctctgtgcgctcctggcg
atgctggctgtcgcctccgccagcggcagggatctagcttcagaccggggcttcctgacc
accgtgctgtgtgcgctcggtggcttctcgctgctcctgggcctggcttcccgcgagcaa
cgactgcagcgctggacacgtcccctgtcagtcctcgtgtgggctgcgctactcgggcta
ggccatggcttcctgttcaccgggggcctggtgagcgcctgggaccaggtgtcctttttc
ctcttcgtcatcttcaccgtgtacgccatgttgcccttgggcatgcgggatgccgccgcc
gggggccttgcctcgtcgctttcccacctgctggcccttgggctgtaccttgggcctcag
cgggactccaggccagcgctgctgccgcagctggcagcgaacgccgtgttgttcttgtgc
gggaacgtggccggagcgtaccacaaggcgctgatggagcgcgctctgcgcgccacgttc
cgggaggctcttcgttccctgcactcgcgccggcggctggacacagagaagaagcaccag
gaacaccttctcttgtccattcttcctgcctacctggcccgagagatgaaggcagagatc
atggcacggctgcaggctggacaggggtcccggccagagagcaccaacaacttccacagc
ctctatgtcaagaggcaccagggagtgagcgtgctgtatgctgacatcgtgggcttcaca
cggctggccagtgagtgctcccctaaggagctggtgctcatgctcaacgagctcttcggc
aagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctgggagactgt
tactactgtgtctctggtctaccgctctccctgccagaccacgccatcaactgcgtgcgc
atggggctggacatgtgccgggccatcaggaaactccgggcggccactggcgtggacatc
aacatgcgtgtgggcgtgcattcgggcagtgtgctctgcggagtcattgggctgcagaag
tggcagtatgatgtctggtcccatgatgtcacactggccaaccacatggaggcgggcggc
gtgccaggacgagtacatattacaggggctaccctggccctgctggccggggtctatgct
gtggaagatgcatcgatggaacaccgggacccataccttcgggagctaggggagcccacc
tacctagtcatcgacccccgggctgaggaggaggatgagaagggcactgcgggagggctg
ctgtcctctctcgagggcccccagatgcgcccatcactgctgatgacccgctacctggag
tcctggggcgcggccaagccttttgcccatctgagccacctagagagccctgtgtccact
tccacccctctcccggagaaggccctggcctccttcagcccccagtggagcctggaccgg
agccgtaccccccggggactagatgaggacctggacactggggatgccaagttcttccag
gtcatcgaacagctcaactctcagaagcagtggaagcagtccaaggacttcaacccactg
acactgtacttcagagagaaggagctggagaaagagtatcgactttctgccctccccgcc
ttcaaatactatgcggcctgcaccttcctggtcttcttctccaacttcatcatccagatg
ctggtggccaacaggccgccagctctggccatcacctatagcatcaccttcctcctcttc
ctcctcctcctcttcgtctgcttctcagagcacctgacgaagtgtgtcttgaaaggcccc
aagatgctgcactggctgcccgcactgtctggcttggtggccacacggcccggactccga
gttgccctgggcactgccaccatcctcctcgtttttgtcatggctattaccagcctgttc
ttcttaccggcggcaacaaactgcccttcccgggcttccaatgtgtcctccgtggcttcc
aacgtctcctgggagctccctggctccctgcctctcatcagcgtcccatactctatgcac
tgctgcgtgctggggttcctgtcctgctccctctttctgcacatgagcttcgagctgaag
ttgctgctgctcctgctatggctgggggtctcctgctccctcttcctgcactcccacgcc
tggctgtccgactgcctcatcgcccgcctctatccagatcccttggactccaggccaggg
gtgctgaaggagcccaaactgatgggagctatctccttcttcatcttcttcttcaccctc
cttgtcctggctcggcagaatgagtactactgccgcctggacttcctgtggaagaagaag
ctgcggcaggagcaggaggagacagagaccatggagaacctgactcggctgctgctggag
aatgtgctccctgcgcacgtggccccccagttcattggccagaaccggcgcaacgaggac
ctctaccaccagtcctacgagtgtgtctgtgtcctcttcgcctcagttccagactttaag
gagttttactctgaatctaacatcaaccacgagggtctagagtgtctgcggttgctcaat
gagatcatcgctgattttgatgagctgctctcaaagcccaagtttagcggcgtggagaag
atcaaaaccatcggcagcacctacatggcagccacgggcttaaatgccacccccggacag
gacgcacagcaggatgccgagcgaagctgcagccacctgggcaccatggtggagttcgca
gtggccctcggatcgaagctggatgtcatcaacaagcactcattcaacaacttccgcctg
cgtgtggggttgaaccacggacctgtagtggctggggtggttggggcccagaagcctcag
tatgacatctggggcaacacggtgaacgtggccagccgcatggaaagtacgggagtcctg
ggcaagatccaagtgactgaagagacagcccgggtgctgcagtccttaggctatacctgc
tacagccggggcatcatcaaggtcaaaggcaaagggcagctgtgcacctacttcctgaac
acagatttgacacgaactggccctccctcggccaccctaggctga

DBGET integrated database retrieval system