KEGG   Ursus maritimus (polar bear): 103679569
Entry
103679569         CDS       T03271                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00100  Steroid biosynthesis
umr01100  Metabolic pathways
Module
umr_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103679569 (TM7SF2)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103679569 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 103679569
NCBI-ProteinID: XP_008707354
UniProt: A0A384DKQ7
Position
Un
AA seq 380 aa
MASPQGSRAPLEFGGPLGNGAGVESGVRLREGGENCKRRAALCPQVAEGQELKDKSRLRY
PINGFQALVLTALLVGLAVSAGLPLGALPEMLLPLAFAATLTAFIFSLLLYLKALVAPAS
ALAPGGNSGNPIYDFFLGRELNPRIWSFDFKYFCELRPGLIGWVLINLALLMQEAELRGS
PSLAMWLVNGFQLLYVGDALWHEEAVLTTMDITHDGFGFMLAFGDLAWVPFTYSLQAQFL
LHHPQPLGLPMASVICLINAVGYYIFRGANSQKNTFRKNPSDPRVACLETIPRATGRQLL
VSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFYVLYFTALLVHREARDEQQCLRKY
GLAWREYCRRVPYRILPYVY
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcctctcctcagggctcccgggctccgctggaattcgggggacccctgggtaatggg
gcgggggtggaatctggggtcaggctccgcgagggcggggagaactgcaaacggcgagcc
gctttgtgcccgcaggtggccgagggacaggaattgaaggacaagagtcgcctgcgctac
cccattaacggcttccaggccctggtgctgacagccctgttggtgggcttggctgtgtcg
gctgggctgcctctgggggcgctcccagaaatgctcctgcccttggccttcgcggccacc
ctcaccgccttcatcttcagcctccttctctatctgaaggctctggtggcccctgcctcg
gccctggcacctggggggaactcaggcaatcccatctatgacttcttcctgggacgggag
ctcaacccgcgcatctggtccttcgacttcaaatatttctgtgaactgcggcctggcctc
atcggctgggtcctcatcaacctggccctgctgatgcaggaagcggaacttcgggggagt
ccctccctggccatgtggctggtcaatggcttccagctactctatgtgggtgatgccctc
tggcatgaggaggctgttctcaccaccatggacatcacacacgacggctttggcttcatg
ctggcctttggggacctagcctgggtacccttcacttacagcctgcaggcccagttcctg
ctccaccacccgcagcccctggggctgcccatggcctcagtcatctgcctcatcaatgct
gttggttactacatcttccgaggagccaattcccagaagaacaccttccggaagaatcct
tctgaccccagagtggcttgccttgagaccatccccagagccacggggcggcagctgctg
gtgtctgggtggtggggtatggtccgccatcccaactaccttggagacctcatcatggct
ctggcctggtccttgccctgtggagtgtctcacctgctgccctatttctacgtcctctac
ttcacggcactgctggtgcaccgcgaggcccgggacgagcagcagtgcctgcgcaagtac
ggcctggcctggcgcgagtactgccggcgcgtgccttaccgaatcctgccctacgtctac
tga

DBGET integrated database retrieval system