KEGG   Ursus maritimus (polar bear): 103680072Help
Entry
103680072         CDS       T03271                                 

Gene name
HBB
Definition
(RefSeq) hemoglobin subunit beta
  KO
K13823  hemoglobin subunit beta
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr05143  African trypanosomiasis
umr05144  Malaria
Brite
KEGG Orthology (KO) [BR:umr00001]
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05144 Malaria
    103680072 (HBB)
   05143 African trypanosomiasis
    103680072 (HBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103680072 (HBB)
Membrane trafficking [BR:umr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103680072 (HBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin
Motif
Other DBs
NCBI-GeneID: 103680072
NCBI-ProteinID: XP_008707834
UniProt: A0A384DLF1
Position
Un
AA seq 147 aa AA seqDB search
MVHLTGEEKSLVTGLWGKVNVDEVGGEALGRLLVVYPWTQRFFDSFGDLSSADAIMNNPK
VKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFG
KEFTPQVQAAYQKVVAGVANALAHKYH
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatctgactggtgaggagaagtctctcgtcaccggcctgtggggcaaggtgaac
gtggatgaagttggtggtgaggccctgggcaggcttctggttgtctacccctggactcag
aggttctttgactcctttggggacctgtcctctgctgatgctattatgaacaaccccaag
gtcaaggcccatggcaagaaggtgctgaactcctttagtgatggcctgaagaatctggac
aacctcaagggcacctttgctaagctgagcgagctgcactgtgacaagctgcacgtggat
cccgagaacttcaagctcctgggcaacgtgctggtgtgtgtgctggctcaccactttggc
aaagagttcacccctcaggtgcaggctgcctatcagaaggtggtggctggtgtggccaat
gccctggcccacaagtaccactga

DBGET integrated database retrieval system