KEGG   Ursus maritimus (polar bear): 103680185Help
Entry
103680185         CDS       T03271                                 

Gene name
ATP1A3
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04260  Cardiac muscle contraction
umr04261  Adrenergic signaling in cardiomyocytes
umr04911  Insulin secretion
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04960  Aldosterone-regulated sodium reabsorption
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04964  Proximal tubule bicarbonate reclamation
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04973  Carbohydrate digestion and absorption
umr04974  Protein digestion and absorption
umr04976  Bile secretion
umr04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103680185 (ATP1A3)
   04022 cGMP-PKG signaling pathway
    103680185 (ATP1A3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103680185 (ATP1A3)
   04918 Thyroid hormone synthesis
    103680185 (ATP1A3)
   04919 Thyroid hormone signaling pathway
    103680185 (ATP1A3)
   04925 Aldosterone synthesis and secretion
    103680185 (ATP1A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103680185 (ATP1A3)
   04261 Adrenergic signaling in cardiomyocytes
    103680185 (ATP1A3)
  09154 Digestive system
   04970 Salivary secretion
    103680185 (ATP1A3)
   04971 Gastric acid secretion
    103680185 (ATP1A3)
   04972 Pancreatic secretion
    103680185 (ATP1A3)
   04976 Bile secretion
    103680185 (ATP1A3)
   04973 Carbohydrate digestion and absorption
    103680185 (ATP1A3)
   04974 Protein digestion and absorption
    103680185 (ATP1A3)
   04978 Mineral absorption
    103680185 (ATP1A3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103680185 (ATP1A3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103680185 (ATP1A3)
   04964 Proximal tubule bicarbonate reclamation
    103680185 (ATP1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103680185 (ATP1A3)
Enzymes [BR:umr01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     103680185 (ATP1A3)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103680185 (ATP1A3)
  Exosomal proteins of other body fluids (saliva and urine)
   103680185 (ATP1A3)
  Exosomal proteins of colorectal cancer cells
   103680185 (ATP1A3)
  Exosomal proteins of bladder cancer cells
   103680185 (ATP1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 103680185
NCBI-ProteinID: XP_008707938
UniProt: A0A384DLQ1
Position
Un
AA seq 875 aa AA seqDB search
MAPETSGGSDSYRVATSQDKKDDKGSPKKSKGTKERRDLDDLKKEVAMTEHKMSVEEVCR
KYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFL
AYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNIVPQQALVIR
EGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTH
DNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQ
LITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAR
KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDK
SSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRER
NKKVAEIPFNSTNKYQLPALPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQ
QKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFA
SIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDM
VPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAEN
GFLPSNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLII
CKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSF
LIFVYDEIRKLILARKPGGWRGLRQRQATLSSLEQ
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggcgccagagacatctggtggctctgacagctatcgtgtcgccacctcgcaggacaag
aaagatgacaagggctcgcccaagaagagcaagggcaccaaagagcgcagggacctggat
gacctcaagaaggaggtggctatgacagagcacaagatgtcagtggaagaggtctgccgg
aaatacaacacagactgtgtgcagggtctgacccacagcaaagctcaagagatcctggcc
cgggatgggcctaatgcgctcacaccaccgcctaccaccccagaatgggtcaagttctgc
cgccagctcttcgggggcttctcaatcctgctgtggattggagccatcctctgcttcctg
gcctatggcatccaggcgggcacagaggacgacccctcgggtgacaatctatatctgggc
atcgtgttggcggctgtggtcatcatcaccggctgcttctcctactaccaggaggccaag
agctccaagatcatggagtccttcaagaacatagttccccagcaagccctggtgatccgt
gagggggagaagatgcaggtgaacgctgaggaggtggtggttggggacctggtggagatc
aagggtggagaccgagtcccggccgacctacgaatcatctcagcccatggttgcaaggtg
gacaactcctccctgaccggcgaatcagaaccacagacccgctctcctgactgcacacac
gacaaccccttggagactcggaacattaccttcttttctaccaactgcgtggaaggcaca
gctcgcggcgtggtggtggccacgggtgaccgcactgtcatgggccgcattgccacgctg
gcttcaggcctggaggtgggcaagacgcccatcgccatcgagatcgagcacttcatccag
ctcatcaccggtgtggctgtcttcctgggcgtctccttcttcatcctgtccctcattctc
gggtacacctggcttgaggctgtcatcttcctcatcggcatcatcgtggccaatgtccca
gagggcctgctggccaccgtcactgtgtgtctgacgctgacggccaaacgcatggcgcgg
aagaactgcctggtgaaaaacctggaggctgtcgagaccctgggctccacatccaccatc
tgctcggacaagacagggaccctcacccagaaccgcatgacggttgcccacatgtggttt
gacaaccagatccatgaggccgacaccaccgaggaccagtcaggcacctcgttcgacaag
agctcgcacacctgggtggccctgtcccacattgccggactctgcaaccgtgccgtcttc
aagggaggtcaggacaacatccctgtgctcaagagggatgtggctggggatgcctctgag
tctgccctgctcaagtgcatcgagctgtcctctggctctgtgaagctgatgcgagaacga
aacaagaaagtggccgagattcccttcaattccaccaacaaataccagctccctgctctt
cccagggatgccaaggcctgtgtgatccatggcactgatcttaaggacttcacctcggag
caaatcgacgagatcctgcagaaccacacggagatcgtcttcgcccgcacgtccccccag
cagaagctcattattgtggaaggctgtcagagacagggagccatcgtggctgtgaccggg
gatggcgtgaacgactcccccgccctgaagaaggcagacatcggggtggccatgggcatt
gccggctcggacgtgtccaagcaggcagcggacatgattctgctggatgacaactttgcc
tccatcgtcacgggtgtggaggagggccgcctgatcttcgacaacttgaagaaatccatc
gcctacaccctgaccagcaacatccctgagatcacgcccttcttgctattcattatggcc
aacatcccactgcctctgggcaccatcaccatcctctgcatcgacctgggcactgacatg
gtccctgccatctcattggcatacgaggctgcagagagtgacatcatgaagagacagccc
agaaacccccgcaccgacaaactggtcaatgagaggctcatcagcatggcctatgggcag
attggaatgatccaggctctcggtggcttcttttcctactttgtgatcctggcagaaaat
ggtttcttacccagcaacctggtgggcatccggctgaactgggacgaccgcaccgtcaat
gacctggaggacagttacgggcagcagtggacctacgagcagaggaaggtggtggagttc
acgtgccacacggccttcttcgtgagcatcgtggtcgtgcagtgggccgacttgatcatc
tgcaagacccggaggaactcggtcttccagcagggcatgaagaacaagatcctgatcttc
gggctgtttgaggagacggcgctcgctgccttcctgtcctattgccctggcatggacgtg
gctctccgcatgtaccctctcaagcccagctggtggttctgtgccttcccttacagtttc
ctcatcttcgtctacgacgagatccgcaaactcatcctagcgaggaagcccggcggctgg
agagggctacggcagagacaggccacactgtccagcctggagcagtag

DBGET integrated database retrieval system