KEGG   Ursus maritimus (polar bear): 103682563Help
Entry
103682563         CDS       T03271                                 

Gene name
PRODH2
Definition
(RefSeq) proline dehydrogenase 2
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00330  Arginine and proline metabolism
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    103682563 (PRODH2)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     103682563 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 103682563
NCBI-ProteinID: XP_008710447
UniProt: A0A384DTS1
Position
Un
AA seq 461 aa AA seqDB search
MMLRTCHVLCSQAGPSAGGWQPLSFDGGAFHLKGTGELTRALLVLRLCAWPPLVTHGLAL
QAWSRRLLGSRLSGALLRASIYGQFVAGETAEEVKGCVQQLQTLGLRPLLAVPTEEEPDS
AVKTGEAWYEGNFSAMLRCVDLSRGILETPGPTGNILMQLKVTALTSTRLCKDLTSWIRK
PGASLELSPERLAEAMDSGRDLQVSCLNTQQNQHLQASLSRLHRVAQHARAQHVRLLVDA
EYTFLNPALSLLVDALAMRWNGPGEGGPWVWNTYQAYLKDTHERLRRGAEAADRAGLAFG
VKLVRGAYLDKEREVARHHGTEDPTQLDYEATSRSYSHCLELMLTHVSHRGPMCHLMVAS
HNEESVRQATKRMWELGIPLDGPVCFGQLLGMCDHVSLALGQAGYAVYKSIPYGSLEEVI
PYLIRRAQENRSVLQGARREQKLLSQELWKRVLGRGLRAHH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttcggacctgtcatgtgctctgttcccaagctggaccctctgctgggggctgg
cagcccctgagctttgatggtggggcttttcacctcaaaggcacaggagaactgacacga
gctttgttggtgctgcggctgtgtgcctggccccccctggtcacacatggcctggcgctc
caggcctggtctcggcgactcctgggctcccggctctcgggcgcacttctccgagcatct
atctacgggcagtttgtggctggtgagacagcagaggaagtgaagggctgtgtccaacag
ctccagaccctaggccttcggcccctgctggccgtacccactgaagaggagccagactca
gctgtcaagactggtgaggcctggtatgagggaaacttcagtgctatgcttcggtgtgtg
gacctgtcacggggcatcctggagacccctggcccaactgggaacatccttatgcagctg
aaggtgacggcgctgaccagtactcggctctgtaaggacctaacctcatggatcagaaaa
ccaggggcttccttggagctaagccctgagaggctggcagaagccatggactctgggcgg
gatctccaggtctcctgtctcaacacccagcaaaaccagcatctccaggcctctctgagc
cgcttacaccgggtagcccagcatgcccgggcccagcacgtgaggctgctggtggatgcc
gagtacaccttcctgaacccggctctctctctgctggtggatgccctggccatgcgctgg
aacggccccggggaaggcgggccctgggtgtggaacacttaccaggcctatctgaaggac
acacacgagcggctgaggcggggcgcggaggccgctgacagggctggcctggccttcgga
gtcaagttggtacgaggggcatatctggacaaggagagagaggtggctcggcaccacggg
acagaagaccccactcagctggactatgaggctaccagtcggagttacagccactgcctg
gagctgatgctgacccatgtgtcccaccgtggccccatgtgccacctcatggtggcttcc
cacaatgaggaatctgttcgccaggcaactaagcgcatgtgggagctgggcattcctctg
gatgggcccgtctgttttggacaacttttagggatgtgtgaccacgtctccttggcactg
gggcaggccggctatgccgtgtataagtccatcccttatggctccctggaggaggtgatc
ccctacctgatccggagggcccaggagaaccggagtgtgctgcagggtgcccgcagggaa
cagaagctgctcagccaagaactttggaagagagtgttggggcggggcctgagggcacac
cattag

DBGET integrated database retrieval system