GenomeNet

Database: UniProt
Entry: A2VEC9
LinkDB: A2VEC9
Original site: A2VEC9 
ID   SSPO_HUMAN              Reviewed;        5150 AA.
AC   A2VEC9; A0A096LNW2; Q76B61;
DT   12-JUN-2007, integrated into UniProtKB/Swiss-Prot.
DT   28-MAR-2018, sequence version 2.
DT   08-MAY-2019, entry version 108.
DE   RecName: Full=SCO-spondin {ECO:0000305};
DE   Flags: Precursor;
GN   Name=SSPO {ECO:0000312|HGNC:HGNC:21998}; Synonyms=KIAA2036;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RC   TISSUE=Brain;
RA   Nagase T., Kikuno R., Ohara O.;
RT   "The nucleotide sequence of a long cDNA clone isolated from human.";
RL   Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases.
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=12853948; DOI=10.1038/nature01782;
RA   Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H.,
RA   Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R.,
RA   Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E.,
RA   Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H.,
RA   Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A.,
RA   Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J.,
RA   Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A.,
RA   Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S.,
RA   Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M.,
RA   Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C.,
RA   Latreille P., Miller N., Johnson D., Murray J., Woessner J.P.,
RA   Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J.,
RA   Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L.,
RA   Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R.,
RA   Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E.,
RA   Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K.,
RA   Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S.,
RA   Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M.,
RA   Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R.,
RA   Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D.,
RA   Waterston R.H., Wilson R.K.;
RT   "The DNA sequence of human chromosome 7.";
RL   Nature 424:157-164(2003).
RN   [3]
RP   IDENTIFICATION (ISOFORM 1).
RX   PubMed=17126404; DOI=10.1016/j.brainresrev.2006.09.007;
RA   Meiniel O., Meiniel A.;
RT   "The complex multidomain organization of SCO-spondin protein is highly
RT   conserved in mammals.";
RL   Brain Res. Brain Res. Rev. 53:321-327(2007).
RN   [4]
RP   ANALYSIS OF TSP TYPE-1 DOMAINS.
RX   PubMed=30520531; DOI=10.1002/prot.25640;
RA   Stoddard S.V., Welsh C.L., Palopoli M.M., Stoddard S.D.,
RA   Aramandla M.P., Patel R.M., Ma H., Beck L.H. Jr.;
RT   "Structure and function insights garnered from in silico modeling of
RT   the thrombospondin type-1 domain-containing 7A antigen.";
RL   Proteins 87:136-145(2019).
RN   [5]
RP   VARIANTS TRP-1002 AND CYS-2799.
RX   PubMed=26477546; DOI=10.1016/j.ajhg.2015.09.009;
RG   Care4Rare Canada Consortium;
RA   Srour M., Hamdan F.F., McKnight D., Davis E., Mandel H.,
RA   Schwartzentruber J., Martin B., Patry L., Nassif C.,
RA   Dionne-Laporte A., Ospina L.H., Lemyre E., Massicotte C.,
RA   Laframboise R., Maranda B., Labuda D., Decarie J.C., Rypens F.,
RA   Goldsher D., Fallet-Bianco C., Soucy J.F., Laberge A.M., Maftei C.,
RA   Boycott K., Brais B., Boucher R.M., Rouleau G.A., Katsanis N.,
RA   Majewski J., Elpeleg O., Kukolich M.K., Shalev S., Michaud J.L.;
RT   "Joubert Syndrome in French Canadians and Identification of Mutations
RT   in CEP104.";
RL   Am. J. Hum. Genet. 97:744-753(2015).
CC   -!- FUNCTION: Involved in the modulation of neuronal aggregation. May
CC       be involved in developmental events during the formation of the
CC       central nervous system (By similarity). {ECO:0000250}.
CC   -!- SUBCELLULAR LOCATION: Secreted, extracellular space {ECO:0000250}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=A2VEC9-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=A2VEC9-2; Sequence=VSP_035258, VSP_035259, VSP_035260,
CC                                  VSP_035261, VSP_035262, VSP_035263;
CC         Note=No experimental confirmation available.;
CC   -!- SIMILARITY: Belongs to the thrombospondin family. {ECO:0000305}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=BAC98376.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
DR   EMBL; AB111888; BAC98376.1; ALT_INIT; mRNA.
DR   EMBL; AC004877; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; KF459635; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; KF495712; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; KF459640; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BN000852; CAJ43920.1; -; mRNA.
DR   RefSeq; NP_940857.2; NM_198455.2.
DR   SMR; A2VEC9; -.
DR   BioGrid; 116762; 5.
DR   iPTMnet; A2VEC9; -.
DR   PhosphoSitePlus; A2VEC9; -.
DR   BioMuta; SSPO; -.
DR   PRIDE; A2VEC9; -.
DR   ProteomicsDB; 545; -.
DR   ProteomicsDB; 546; -. [A2VEC9-2]
DR   Ensembl; ENST00000378016; ENSP00000485256; ENSG00000197558. [A2VEC9-1]
DR   GeneID; 23145; -.
DR   KEGG; hsa:23145; -.
DR   CTD; 23145; -.
DR   DisGeNET; 23145; -.
DR   GeneCards; SSPO; -.
DR   H-InvDB; HIX0007194; -.
DR   HGNC; HGNC:21998; SSPO.
DR   MIM; 617356; gene.
DR   neXtProt; NX_A2VEC9; -.
DR   OpenTargets; ENSG00000197558; -.
DR   PharmGKB; PA142670865; -.
DR   GeneTree; ENSGT00940000155829; -.
DR   HOGENOM; HOG000154433; -.
DR   InParanoid; A2VEC9; -.
DR   OMA; MQTKNEL; -.
DR   OrthoDB; 12226at2759; -.
DR   PhylomeDB; A2VEC9; -.
DR   Reactome; R-HSA-5083635; Defective B3GALTL causes Peters-plus syndrome (PpS).
DR   Reactome; R-HSA-5173214; O-glycosylation of TSR domain-containing proteins.
DR   ChiTaRS; SSPO; human.
DR   GeneWiki; SSPO; -.
DR   GenomeRNAi; 23145; -.
DR   PRO; PR:A2VEC9; -.
DR   Proteomes; UP000005640; Chromosome 7.
DR   Bgee; ENSG00000197558; Expressed in 106 organ(s), highest expression level in right hemisphere of cerebellum.
DR   GO; GO:0005615; C:extracellular space; TAS:BHF-UCL.
DR   GO; GO:0030414; F:peptidase inhibitor activity; IEA:InterPro.
DR   GO; GO:0007155; P:cell adhesion; IEA:UniProtKB-KW.
DR   GO; GO:0030154; P:cell differentiation; IEA:InterPro.
DR   GO; GO:0007399; P:nervous system development; IEA:InterPro.
DR   CDD; cd00057; FA58C; 1.
DR   CDD; cd00112; LDLa; 9.
DR   Gene3D; 2.20.100.10; -; 21.
DR   Gene3D; 2.60.120.260; -; 1.
DR   Gene3D; 4.10.400.10; -; 9.
DR   InterPro; IPR006207; Cys_knot_C.
DR   InterPro; IPR000421; FA58C.
DR   InterPro; IPR008979; Galactose-bd-like_sf.
DR   InterPro; IPR036055; LDL_receptor-like_sf.
DR   InterPro; IPR023415; LDLR_class-A_CS.
DR   InterPro; IPR002172; LDrepeatLR_classA_rpt.
DR   InterPro; IPR036201; Pacifastin_dom_sf.
DR   InterPro; IPR030119; SCO-spondin.
DR   InterPro; IPR036084; Ser_inhib-like_sf.
DR   InterPro; IPR002919; TIL_dom.
DR   InterPro; IPR000884; TSP1_rpt.
DR   InterPro; IPR036383; TSP1_rpt_sf.
DR   InterPro; IPR014853; Unchr_dom_Cys-rich.
DR   InterPro; IPR001007; VWF_dom.
DR   InterPro; IPR001846; VWF_type-D.
DR   PANTHER; PTHR11339:SF358; PTHR11339:SF358; 1.
DR   Pfam; PF08742; C8; 3.
DR   Pfam; PF00754; F5_F8_type_C; 1.
DR   Pfam; PF00057; Ldl_recept_a; 8.
DR   Pfam; PF01826; TIL; 12.
DR   Pfam; PF00090; TSP_1; 21.
DR   Pfam; PF00094; VWD; 3.
DR   PRINTS; PR00261; LDLRECEPTOR.
DR   SMART; SM00832; C8; 3.
DR   SMART; SM00231; FA58C; 1.
DR   SMART; SM00192; LDLa; 10.
DR   SMART; SM00209; TSP1; 25.
DR   SMART; SM00214; VWC; 6.
DR   SMART; SM00215; VWC_out; 9.
DR   SMART; SM00216; VWD; 3.
DR   SUPFAM; SSF49785; SSF49785; 1.
DR   SUPFAM; SSF57283; SSF57283; 1.
DR   SUPFAM; SSF57424; SSF57424; 10.
DR   SUPFAM; SSF57567; SSF57567; 14.
DR   SUPFAM; SSF82895; SSF82895; 23.
DR   PROSITE; PS01225; CTCK_2; 1.
DR   PROSITE; PS00022; EGF_1; 1.
DR   PROSITE; PS50022; FA58C_3; 1.
DR   PROSITE; PS01209; LDLRA_1; 8.
DR   PROSITE; PS50068; LDLRA_2; 10.
DR   PROSITE; PS50092; TSP1; 25.
DR   PROSITE; PS01208; VWFC_1; 1.
DR   PROSITE; PS50184; VWFC_2; 2.
DR   PROSITE; PS51233; VWFD; 3.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Calcium; Cell adhesion; Complete proteome;
KW   Disulfide bond; EGF-like domain; Glycoprotein; Polymorphism;
KW   Reference proteome; Repeat; Secreted; Signal.
FT   SIGNAL        1     17       {ECO:0000255}.
FT   CHAIN        18   5150       SCO-spondin.
FT                                /FTId=PRO_5000223757.
FT   DOMAIN       18    102       EMI.
FT   DOMAIN      194    398       VWFD 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00580}.
FT   DOMAIN      470    525       TIL 1. {ECO:0000255}.
FT   DOMAIN      564    774       VWFD 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00580}.
FT   DOMAIN      828    881       TIL 2. {ECO:0000255}.
FT   DOMAIN      881    940       VWFC 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00220}.
FT   DOMAIN      924    975       TIL 3. {ECO:0000255}.
FT   DOMAIN     1014   1220       VWFD 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00580}.
FT   DOMAIN     1276   1332       TIL 4. {ECO:0000255}.
FT   DOMAIN     1376   1413       LDL-receptor class A 1.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     1416   1451       LDL-receptor class A 2.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     1452   1488       LDL-receptor class A 3.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     1492   1530       LDL-receptor class A 4.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     1565   1601       LDL-receptor class A 5.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     1603   1642       LDL-receptor class A 6.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     1656   1694       LDL-receptor class A 7.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     1695   1749       TSP type-1 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     1751   1809       TSP type-1 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     1825   1864       EGF-like 1.
FT   DOMAIN     1865   1902       EGF-like 2.
FT   DOMAIN     1910   1966       TSP type-1 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     1966   2026       VWFC 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00220}.
FT   DOMAIN     2066   2225       F5/8 type C. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00081}.
FT   DOMAIN     2234   2270       LDL-receptor class A 8.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     2391   2427       LDL-receptor class A 9.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     2464   2500       LDL-receptor class A 10.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DOMAIN     2501   2554       TSP type-1 4. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     2556   2611       TSP type-1 5. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     2633   2676       TIL 5. {ECO:0000255}.
FT   DOMAIN     2716   2770       TSP type-1 6. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     2773   2829       TSP type-1 7. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     2831   2884       TSP type-1 8. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     2986   3041       TSP type-1 9. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     3042   3084       TSP type-1 10. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     3091   3143       TIL 6. {ECO:0000255}.
FT   DOMAIN     3184   3251       TSP type-1 11. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     3253   3308       TSP type-1 12. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     3316   3366       TIL 7. {ECO:0000255}.
FT   DOMAIN     3409   3471       TSP type-1 13. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     3473   3528       TSP type-1 14. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     3530   3586       TIL 8. {ECO:0000255}.
FT   DOMAIN     3646   3694       TSP type-1 15. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     3812   3868       TSP type-1 16. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     3882   3934       TSP type-1 17. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     3948   4004       TSP type-1 18. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     4006   4061       TSP type-1 19. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     4064   4119       TIL 9. {ECO:0000255}.
FT   DOMAIN     4161   4214       TSP type-1 20. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     4255   4307       TSP type-1 21. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     4309   4365       TSP type-1 22. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     4367   4421       TSP type-1 23. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     4425   4480       TIL 10. {ECO:0000255}.
FT   DOMAIN     4617   4667       TSP type-1 24. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     4678   4726       TIL 11. {ECO:0000255}.
FT   DOMAIN     4766   4819       TSP type-1 25. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00210}.
FT   DOMAIN     4821   4875       TIL 12. {ECO:0000255}.
FT   DOMAIN     4987   5045       VWFC 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00220}.
FT   DOMAIN     5044   5143       CTCK. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00039}.
FT   CARBOHYD     88     88       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    130    130       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    261    261       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    515    515       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    820    820       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    912    912       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    945    945       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    987    987       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1353   1353       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1651   1651       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1664   1664       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1810   1810       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1994   1994       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2031   2031       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2134   2134       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2646   2646       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2695   2695       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2937   2937       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2968   2968       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3063   3063       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3117   3117       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3164   3164       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3174   3174       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3311   3311       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3400   3400       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3513   3513       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3523   3523       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3600   3600       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3627   3627       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3793   3793       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3916   3916       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3948   3948       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4141   4141       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4348   4348       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4419   4419       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4734   4734       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4751   4751       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4756   4756       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4866   4866       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4906   4906       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4951   4951       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   4958   4958       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   5064   5064       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   DISULFID   1377   1390       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1384   1403       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1397   1412       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1417   1429       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1424   1442       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1436   1453       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1453   1465       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1460   1478       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1472   1487       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1493   1505       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1500   1518       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1512   1529       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1566   1578       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1573   1591       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1585   1600       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1604   1617       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1611   1630       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1624   1641       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1657   1667       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1662   1680       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1674   1695       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   1707   1743       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   1711   1748       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   1722   1733       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   1763   1803       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   1767   1808       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   1777   1787       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   1911   1950       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   1922   1926       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   1960   1965       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2066   2225       {ECO:0000255|PROSITE-ProRule:PRU00081}.
FT   DISULFID   2235   2247       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   2242   2260       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   2254   2269       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   2392   2404       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   2399   2417       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   2411   2426       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   2465   2477       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   2472   2490       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   2484   2499       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID   2502   2538       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2513   2517       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2548   2553       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2568   2605       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2572   2610       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2583   2595       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2717   2755       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2728   2732       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2765   2769       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2785   2823       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2789   2828       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2805   2813       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2843   2878       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2847   2883       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2858   2868       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2987   3025       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   2998   3002       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3035   3040       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3196   3245       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3200   3250       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3211   3235       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3265   3302       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3269   3307       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3280   3292       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3421   3464       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3425   3470       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3436   3448       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3485   3520       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3488   3527       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3498   3510       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3658   3688       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3662   3693       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3673   3678       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3824   3862       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3828   3867       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3840   3852       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3949   3985       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3960   3964       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   3998   4003       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4018   4055       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4022   4060       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4033   4045       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4162   4198       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4173   4177       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4208   4213       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4368   4405       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4379   4381       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4415   4420       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4778   4813       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4782   4818       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   4793   4802       {ECO:0000255|PROSITE-ProRule:PRU00210}.
FT   DISULFID   5044   5104       {ECO:0000255|PROSITE-ProRule:PRU00039}.
FT   DISULFID   5070   5121       {ECO:0000255|PROSITE-ProRule:PRU00039}.
FT   DISULFID   5080   5137       {ECO:0000255|PROSITE-ProRule:PRU00039}.
FT   DISULFID   5084   5139       {ECO:0000255|PROSITE-ProRule:PRU00039}.
FT   VAR_SEQ       1   1123       Missing (in isoform 2).
FT                                {ECO:0000303|Ref.1}.
FT                                /FTId=VSP_035258.
FT   VAR_SEQ    1124   1127       LWDG -> MLPP (in isoform 2).
FT                                {ECO:0000303|Ref.1}.
FT                                /FTId=VSP_035259.
FT   VAR_SEQ    1640   1640       A -> ACVEAPAPPAMRGPPGQAGGPTSSRAPSPPSPPEAQ
FT                                GEGRKGQERSRTHLTVPAGSTQLPLCPGLFPCGVAPGLCLT
FT                                PEQLCDGIPDCPQGEDELD (in isoform 2).
FT                                {ECO:0000303|Ref.1}.
FT                                /FTId=VSP_035260.
FT   VAR_SEQ    1672   1672       L -> LVRVGVGGGGGSAMLPPSTRALTPLPPQ (in
FT                                isoform 2). {ECO:0000303|Ref.1}.
FT                                /FTId=VSP_035261.
FT   VAR_SEQ    2180   2315       LFPRNWDDLDPAVWTFGRMVQARFVRVWPHDVHHSDVPLQV
FT                                ELLGCEPGSPPAPLCPGVGLRCASGECVLRGGPCDGVLDCE
FT                                DGSDEEGCVLLPEGTGRFHSTAKTLALSSAQPGQLLHWPRE
FT                                GLAETEHWPPGQE -> VSPAQGRWGQQPTMPFCGFHSLCP
FT                                QGPSSVPEGHGLHSMLVEYLVSSRDCALWSRGLGATVTWML
FT                                ETIQVAQTQGRYVKPARERGWGDTKFTEGLREPRPTHVFVE
FT                                SSLGTALPSGGLHPSRRQTARSGRNQSVLC (in
FT                                isoform 2). {ECO:0000303|Ref.1}.
FT                                /FTId=VSP_035262.
FT   VAR_SEQ    2316   5147       Missing (in isoform 2).
FT                                {ECO:0000303|Ref.1}.
FT                                /FTId=VSP_035263.
FT   VARIANT     146    146       Q -> R (in dbSNP:rs709061).
FT                                /FTId=VAR_052660.
FT   VARIANT     298    298       V -> M (in dbSNP:rs17754559).
FT                                /FTId=VAR_052661.
FT   VARIANT     540    540       V -> M (in dbSNP:rs855677).
FT                                /FTId=VAR_059863.
FT   VARIANT    1002   1002       R -> W (found in patient with Joubert
FT                                syndrome; unknown pathological
FT                                significance; dbSNP:rs199648588).
FT                                {ECO:0000269|PubMed:26477546}.
FT                                /FTId=VAR_075709.
FT   VARIANT    1273   1273       S -> P (in dbSNP:rs709060).
FT                                /FTId=VAR_059864.
FT   VARIANT    1274   1274       L -> P (in dbSNP:rs709060).
FT                                /FTId=VAR_052662.
FT   VARIANT    1425   1425       S -> G (in dbSNP:rs855691).
FT                                /FTId=VAR_059865.
FT   VARIANT    1449   1449       P -> Q (in dbSNP:rs855692).
FT                                /FTId=VAR_059866.
FT   VARIANT    1454   1454       P -> R (in dbSNP:rs2074704).
FT                                /FTId=VAR_059867.
FT   VARIANT    1779   1779       S -> P (in dbSNP:rs893601).
FT                                /FTId=VAR_059868.
FT   VARIANT    1794   1794       L -> P (in dbSNP:rs1635802).
FT                                /FTId=VAR_059869.
FT   VARIANT    1883   1883       R -> C (in dbSNP:rs1076277).
FT                                /FTId=VAR_059870.
FT   VARIANT    2018   2018       T -> M (in dbSNP:rs4725314).
FT                                /FTId=VAR_059871.
FT   VARIANT    2453   2453       M -> T (in dbSNP:rs2074689).
FT                                /FTId=VAR_061915.
FT   VARIANT    2542   2542       R -> Q (in dbSNP:rs59522380).
FT                                /FTId=VAR_061916.
FT   VARIANT    2799   2799       R -> C (found in patient with Joubert
FT                                syndrome; unknown pathological
FT                                significance; dbSNP:rs181269877).
FT                                {ECO:0000269|PubMed:26477546}.
FT                                /FTId=VAR_075710.
FT   VARIANT    2892   2892       L -> V (in dbSNP:rs10260959).
FT                                /FTId=VAR_059872.
FT   VARIANT    3274   3274       R -> W (in dbSNP:rs740109).
FT                                /FTId=VAR_059873.
FT   VARIANT    3513   3513       N -> S (in dbSNP:rs10952230).
FT                                /FTId=VAR_059874.
FT   VARIANT    3894   3894       C -> W (in dbSNP:rs1557955).
FT                                /FTId=VAR_059875.
FT   VARIANT    3911   3911       R -> C (in dbSNP:rs745044).
FT                                /FTId=VAR_059876.
FT   VARIANT    4030   4030       S -> I (in dbSNP:rs1005603).
FT                                /FTId=VAR_059877.
FT   VARIANT    4109   4109       Q -> H (in dbSNP:rs12536873).
FT                                /FTId=VAR_061917.
FT   VARIANT    4166   4166       H -> R (in dbSNP:rs10233245).
FT                                /FTId=VAR_059878.
FT   VARIANT    4332   4332       R -> C (in dbSNP:rs1008336).
FT                                /FTId=VAR_059879.
FT   VARIANT    4790   4790       H -> R (in dbSNP:rs1004200).
FT                                /FTId=VAR_059880.
FT   VARIANT    4944   4944       E -> K (in dbSNP:rs12534509).
FT                                /FTId=VAR_059881.
SQ   SEQUENCE   5150 AA;  547841 MW;  14C531CC9A29423E CRC64;
     MLLPALLFGM AWALADGRWC EWTETIRVEE EVAPRQEDLV PCASLDHYSR LGWRLDLPWS
     GRSGLTRSPA PGLCPIYKPP ETRPAKWNRT VRTCCPGWGG AHCTEALAKA SPEGHCFAMW
     QCQLQAGSAN ASAGSLEECC ARPWGQSWWD GSSQACRSCS SRHLPGSASS PALLQPLAGA
     VGQLWSQHQR PSATCASWSG FHYRTFDGRH YHFLGRCTYL LAGAADSTWA VHLTPGDRCP
     QPGHCQRVTM GPEEVLIQAG NVSVKGQLVP EGQSWLLHGL SLQWLGDWLV LSGGLGVVVR
     LDRTGSISIS VDHELWGQTQ GLCGLYNGWP EDDFMEPGGG LAMLAATFGN SWRLPGSESG
     CLDAVEVAQG CDSPLGLIDA DVEPGHLRAE AQDVCHQLLE GPFGQCHAQV SPAEYHEACL
     FAYCAGAMAG SGQEGRQQAV CATFASYVQA CARRHIHIRW RKPGFCERLC PGGQLYSDCV
     SLCPPSCEAV GQGEEESCRE ECVSGCECPR GLFWNGTLCV PAAHCPCYYC RQRYVPGDTV
     RQLCNPCVCR DGRWHCAQAL CPAECAVGGD GHYLTFDGRS YSFWGGQGCR YSLVQDYVKG
     QLLILLEHGA CDAGSCLHAI SVSLEDTHIQ LRDSGAVLVN GQDVGLPWIG AEGLSVRRAS
     SAFLLLRWPG AQVLWGLSDP VAYITLDPRH AHQVQGLCGT FTQNQQDDFL TPAGDVETSI
     AAFASKFQVA GKGRCPSEDS ALLSPCTTHS QRHAFAEAAC AILHSSVFQE CHRLVDKEPF
     YLRCLAAVCG CDPGSDCLCP VLSAYARRCA QEGASPPWRN QTLCPVMCPG GQEYRECAPA
     CGQHCGKPED CGELGSCVAG CNCPLGLLWD PEGQCVPPSL CPCQLGARRY APGSATMKEC
     NRCICQERGL WNCTARHCPS QAFCPRELVY APGACLLTCD SPSANHSCPA GSTDGCVCPP
     GTVLLDERCV PPDLCPCRHS GQWYLPNATI QEDCNVCVCR GRQWHCTGQR RSGRCQASGA
     PHYVTFDGLA FTYPGACEYL LVREASGLFT VSAQNLPCGA SGLTCTKALA VRLEGTVVHM
     LRGRAVTVNG VSVTPPKVYT GPGLSLRRAG LFLLLSTHLG LTLLWDGGTR VLVQLSPQFR
     GRVAGLCGDF DGDASNDLRS RQGVLEPTAE LAAHSWRLSP LCPEPGDLPH PCTMNTHRAG
     WARARCGALL QPLFTLCHAE VPPQQHYEWC LYDACGCDSG GDCECLCSAI ATYADECARH
     GHHVRWRSQE LCSLQCEGGQ VYEACGPTCP PTCHEQHPEP GWHCQVVACV EGCFCPEGTL
     LHGGACLEPA SCPCEWGRNS FPPGSVLQKD CGNCTCQEGQ WHCGGDGGHC EELVPACAEG
     EALCQENGHC VPHGWLCDNQ DDCGDGSDEE GCAAPGCGEG QMTCSSGHCL PLALLCDRQD
     DCGDGTDEPS YPCPQGLLAC ADGRCLPPAL LCDGHPDCLD AADEESCLGQ VTCVPGEVSC
     VDGTCLGAIQ LCDGVWDCPD GADEGPGHCP LPSLPTPPAS TLPGPSPGSL DTASSPLASA
     SPAPPCGPFE FRCGSGECTP RGWRCDQEED CADGSDERGC GGPCAPHHAP CARGPHCVSP
     EQLCDGVRQC PDGSDEGPDA CGGLPALGGP NRTGLPCPEY TCPNGTCIGF QLVCDGQPDC
     GRPGQVGPSP EEQGCGAWGP WSPWGPCSRT CGPWGQGRSR RCSPLGLLVL QNCPGPEHQS
     QACFTAACPV DGEWSTWSPW SVCSEPCRGT MTRQRQCHSP QNGGRTCAAL PGGLHSTRQT
     KPCPQDGCPN ATCSGELMFQ PCAPCPLTCD DISGQVTCPP DWPCGSPGCW CPEGQVLGSE
     GWCVWPRQCP CLVDGARYWP GQRIKADCQL CICQDGRPRR CRLNPDCAVD CGWSSWSPWA
     KCLGPCGSQS IQWSFRSSNN PRPSGRGRQC RGIHRKARRC QTEPCEGCEH QGQVHRVGER
     WHGGPCRVCQ CLHNLTAHCS PYCPLGSCPQ GWVLVEGTGE SCCHCALPGE NQTVQPMATP
     AAAPAPSPQI RFPLATYILP PSGDPCYSPL GLAGLAEGSL HASSQQLEHP TQAALLGAPT
     QGPSPQGWHA GGDAYAKWHT RPHYLQLDLL QPRNLTGILV PETGSSNAYA SSFSLQFSSN
     GLHWHDYRDL LPGILPLPKL FPRNWDDLDP AVWTFGRMVQ ARFVRVWPHD VHHSDVPLQV
     ELLGCEPGSP PAPLCPGVGL RCASGECVLR GGPCDGVLDC EDGSDEEGCV LLPEGTGRFH
     STAKTLALSS AQPGQLLHWP REGLAETEHW PPGQESPTSP TETRPVSPGP ASGVPHHGES
     VQMVTTTPIP QMEARTLPPG MAAVTVVPPH PVTPATPAGQ SVAPGPFPPV QCGPGQTPCE
     VLGCVEQAQV CDGREDCLDG SDERHCARNL LMWLPSLPAL WAASTVPFMM PTMALPGLPA
     SRALCSPSQL SCGSGECLSA ERRCDLRPDC QDGSDEDGCV DCVLAPWSVW SSCSRSCGLG
     LTFQRQELLR PPLPGGSCPR DRFRSQSCFV QACPVAGAWA MWEAWGPCSV SCGGGHQSRQ
     RSCVDPPPKN GGAPCPGASQ ERAPCGLQPC SGGTDCELGR VYVSADLCQK GLVPPCPPSC
     LDPKANRSCS GHCVEGCRCP PGLLLHDTRC LPLSECPCLV GEELKWPGVS FLLGNCSQCV
     CEKGELLCQP GGCPLPCGWS AWSSWAPCDR SCGSGVRARF RSPSNPPAAW GGAPCEGDRQ
     ELQGCHTVCG TEVFGWTPWT SWSSCSQSCL APGGGPGWRS RSRLCPSPGD SSCPGDATQE
     EPCSPPVCPV PSIWGLWAPW STCSAPCDGG IQTRGRSCSS LAPGDTTCPG PHSQTRDCNT
     QPCTAQCPEN MLFRSAEQCH QEGGPCPRLC LTQGPGIECT GFCAPGCTCP PGLFLHNASC
     LPRSQCPCQL HGQLYASGAM ARLDSCNNCT CVSGKMACTS ERCPVACGWS PWTLWSLCSC
     SCNVGIRRRF RAGTAPPAAF GGAECQGPTM EAEFCSLRPC PGPGGEWGPW SPCSVPCGGG
     YRNRTRGSSR SLMEFSTCGL QPCAGPVPGM CPRDKQWLDC AQGPASCAEL SAPRGTNQTC
     HPGCHCPSGM LLLNNVCVPT QDCPCAHEGH LYPPGSTVVR PCENCSCVSG LIANCSSWPC
     AEGEPTWSPW TPWSQCSASC GPARCHRHRF CARSPSAVPS TVAPLPLPAT PTPLCSGPEA
     EEEPCLLQGC DRAGGWGPWG PWSHCSRSCG GGLRSRTRAC DQPPPQGLGD YCEGPRAQGE
     VCQALPCPVT NCTAIEGAEY SPCGPPCPRS CDDLVHCVWR CQPGCYCPPG QVLSSNGAIC
     VQPGHCSCLD LLTGQRHHPG ARLARPDGCN HCTCLEGRLN CTDLPCPVPG GWCPWSEWTM
     CSQPCRGQTR SRSRACACPT PQHGGAPCTG EAGEAGAQHQ REACPSYATC PVDGAWGPWG
     PWSPCDMCLG QSHRSRACSR PPTPEGGRPC PGNHTQSRPC QENSTQCTDC GGGQSLHPCG
     QPCPRSCQDL SPGSVCQPGS VGCQPTCGCP LGQLSQDGLC VPPAHCRCQY QPGAMGIPEN
     QSRSAGSRFS SWESLEPGEV VTGPCDNCTC VAGILQCQEV PDCPDPGVWS SWGPWEDCSV
     SCGGGEQLRS RRCARPPCPG PARQSRTCST QVCREAGCPA GRLYRECQPG EGCPFSCAHV
     TQQVGCFSEG CEEGCHCPEG TFQHRLACVQ ECPCVLTAWL LQELGATIGD PGQPLGPGDE
     LDSGQTLRTS CGNCSCAHGK LSCSLDDCFE ADGGFGPWSP WGPCSRSCGG LGTRTRSRQC
     VLTMPTLSGQ GCRGPRQDLE YCPSPDCPGA EGSTVEPVTG LPGGWGPWSS WSPCSRSCTD
     PARPAWRSRT RLCLANCTMG DPLQERPCNL PSCTELPVCP GPGCGAGNCS WTSWAPWEPC
     SRSCGVGQQR RLRAYRPPGP GGHWCPNILT AYQERRFCNL RACPVPGGWS RWSPWSWCDR
     SCGGGQSLRS RSCSSPPSKN GGAPCAGERH QARLCNPMPC EAGCPAGMEV VTCANRCPRR
     CSDLQEGIVC QDDQVCQKGC RCPKGSLEQD GGCVPIGHCD CTDAQGHSWA PGSQHQDACN
     NCSCQAGQLS CTAQPCPPPT HCAWSHWSAW SPCSHSCGPR GQQSRFRSST SGSWAPECRE
     EQSQSQPCPQ PSCPPLCLQG TRSRTLGDSW LQGECQRCSC TPEGVICEDT ECAVPEAWTL
     WSSWSDCPVS CGGGNQVRTR ACRAAAPHHR SPPCLGPDTQ TRQQPCPGLL EACSWGPWGP
     CSRSCGPGLA SRSGSCPCLM AKADPTCNST FLHLDTQGCY SGPCPEECVW SSWSSWTRCS
     CRVLVQQRYR HQGPASRGAR AGAPCTRLDG HFRPCLISNC SEDSCTPPFE FHACGSPCAG
     LCATHLSHQL CQDLPPCQPG CYCPKGLLEQ AGGCIPPEEC NCWHTSAAGA GMTLAPGDRL
     QLGCKECECR RGELHCTSQG CQGLLPLSEW SEWSPCGPCL PPSALAPASR TALEEHWLRD
     PTGLSPTLAP LLASEQHRHR LCLDPATGRP WTGAPHLCTA PLSQQRLCPD PGACPDSCQW
     SLWGPWSPCQ VPCSGGFRLR WREAEALCGG GCREPWAQES CNGGPCPESC EAQDTVFTLD
     CANQCPHSCA DLWDRVQCLQ GPCRPGCRCP PGQLVQDGRC VPISSCRCGL PSANASWELA
     PAQAVQLDCQ NCTCVNESLV CPHQECPVLG PWSAWSSCSA PCGGGTMERH RTCEGGPGVA
     PCQAQDTEQR QECNLQPCPE CPPGQVLSAC ATSCPCLCWH LQPGAICVQE PCQPGCGCPG
     GQLLHNGTCV PPTACPCTQH SLPWGLTLTL EEQAQELPPG TVLTRNCTRC VCHGGAFSCS
     LVDCQVPPGE TWQQVAPGEL GLCEQTCLEM NATKTQSNCS SARASGCVCQ PGHFRSQAGP
     CVPEDHCECW HLGRPHLPGS EWQEACESCL CLSGRPVCTQ HCSPLTCAQG EEMVLEPGSC
     CPSCRREAPE EQSPSCQLLT ELRNFTKGTC YLDQVEVSYC SGYCPSSTHV MPEEPYLQSQ
     CDCCSYRLDP ESPVRILNLR CLGGHTEPVV LPVIHSCQCS SCQGGDFSKR
//
DBGET integrated database retrieval system