GenomeNet

Database: UniProt
Entry: O14511
LinkDB: O14511
Original site: O14511 
ID   NRG2_HUMAN              Reviewed;         850 AA.
AC   O14511;
DT   15-DEC-1998, integrated into UniProtKB/Swiss-Prot.
DT   01-JAN-1998, sequence version 1.
DT   13-FEB-2019, entry version 166.
DE   RecName: Full=Pro-neuregulin-2, membrane-bound isoform;
DE            Short=Pro-NRG2;
DE   Contains:
DE     RecName: Full=Neuregulin-2;
DE              Short=NRG-2;
DE     AltName: Full=Divergent of neuregulin-1;
DE              Short=DON-1;
DE     AltName: Full=Neural- and thymus-derived activator for ERBB kinases;
DE              Short=NTAK;
DE   Flags: Precursor;
GN   Name=NRG2; Synonyms=NTAK;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
RC   TISSUE=Neuroblastoma;
RX   PubMed=9348101; DOI=10.1093/oxfordjournals.jbchem.a021806;
RA   Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N.,
RA   Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N.,
RA   Ishiguro H.;
RT   "A novel brain-derived member of the epidermal growth factor family
RT   that interacts with ErbB3 and ErbB4.";
RL   J. Biochem. 122:675-680(1997).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS DON-1B AND DON-1R).
RC   TISSUE=Fetal brain;
RX   PubMed=9199335; DOI=10.1128/MCB.17.7.4007;
RA   Busfield S.J., Michnick D.A., Chickering T.W., Revett T.L., Ma J.,
RA   Woolf E.A., Comrack C.A., Dussault B.J., Woolf J., Goodearl A.D.J.,
RA   Gearing D.P.;
RT   "Characterization of a neuregulin-related gene, Don-1, that is highly
RT   expressed in restricted regions of the cerebellum and hippocampus.";
RL   Mol. Cell. Biol. 17:4007-4014(1997).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND ALTERNATIVE SPLICING (ISOFORMS
RP   1; 2; 3; 4; 5 AND 6).
RC   TISSUE=Fetal brain, and Lung;
RX   PubMed=10369162; DOI=10.1007/s004390050961;
RA   Ring H.Z., Chang H., Guilbot A., Brice A., LeGuern E., Francke U.;
RT   "The human neuregulin 2 (NRG2) gene: cloning, mapping and evaluation
RT   as a candidate for the autosomal recessive form of Charcot-Marie-Tooth
RT   disease linked to 5q.";
RL   Hum. Genet. 104:326-332(1999).
RN   [4]
RP   INTERACTION WITH ERBB4.
RX   PubMed=10867024; DOI=10.1074/jbc.C901015199;
RA   Sweeney C., Lai C., Riese D.J. II, Diamonti A.J., Cantley L.C.,
RA   Carraway K.L. III;
RT   "Ligand discrimination in signaling through an ErbB4 receptor
RT   homodimer.";
RL   J. Biol. Chem. 275:19803-19807(2000).
CC   -!- FUNCTION: Direct ligand for ERBB3 and ERBB4 tyrosine kinase
CC       receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors,
CC       resulting in ligand-stimulated tyrosine phosphorylation and
CC       activation of the ERBB receptors. May also promote the
CC       heterodimerization with the EGF receptor.
CC   -!- SUBUNIT: Interacts with ERBB3 and ERBB4.
CC       {ECO:0000269|PubMed:10867024}.
CC   -!- SUBCELLULAR LOCATION: Pro-neuregulin-2, membrane-bound isoform:
CC       Cell membrane {ECO:0000250}; Single-pass type I membrane protein
CC       {ECO:0000250}. Note=Does not seem to be active. {ECO:0000250}.
CC   -!- SUBCELLULAR LOCATION: Neuregulin-2: Secreted {ECO:0000250}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=8;
CC       Name=1;
CC         IsoId=O14511-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=O14511-2; Sequence=VSP_003453;
CC         Note=No experimental confirmation available.;
CC       Name=3;
CC         IsoId=O14511-3; Sequence=VSP_003455;
CC         Note=No experimental confirmation available.;
CC       Name=4;
CC         IsoId=O14511-4; Sequence=VSP_003454;
CC         Note=No experimental confirmation available.;
CC       Name=5;
CC         IsoId=O14511-5; Sequence=VSP_003458, VSP_003459;
CC         Note=No experimental confirmation available. May be produced at
CC         very low levels due to a premature stop codon in the mRNA,
CC         leading to nonsense-mediated mRNA decay.;
CC       Name=6;
CC         IsoId=O14511-6; Sequence=VSP_003456, VSP_003457;
CC         Note=No experimental confirmation available.;
CC       Name=DON-1B;
CC         IsoId=O14511-7; Sequence=VSP_003452, VSP_003455;
CC       Name=DON-1R;
CC         IsoId=O14511-8; Sequence=VSP_003451;
CC   -!- TISSUE SPECIFICITY: Restricted to the cerebellum in the adult.
CC   -!- DOMAIN: The cytoplasmic domain may be involved in the regulation
CC       of trafficking and proteolytic processing. Regulation of the
CC       proteolytic processing involves initial intracellular domain
CC       dimerization (By similarity). {ECO:0000250}.
CC   -!- DOMAIN: ERBB receptor binding is elicited entirely by the EGF-like
CC       domain. {ECO:0000250}.
CC   -!- PTM: Proteolytic cleavage close to the plasma membrane on the
CC       external face leads to the release of the soluble growth factor
CC       form. {ECO:0000250}.
CC   -!- PTM: Extensive glycosylation precedes the proteolytic cleavage.
CC       {ECO:0000250}.
CC   -!- SIMILARITY: Belongs to the neuregulin family. {ECO:0000305}.
DR   EMBL; AB005060; BAA23417.1; -; mRNA.
DR   EMBL; AF119162; AAF28848.1; -; Genomic_DNA.
DR   EMBL; AF119151; AAF28848.1; JOINED; Genomic_DNA.
DR   EMBL; AF119152; AAF28848.1; JOINED; Genomic_DNA.
DR   EMBL; AF119153; AAF28848.1; JOINED; Genomic_DNA.
DR   EMBL; AF119154; AAF28848.1; JOINED; Genomic_DNA.
DR   EMBL; AF119155; AAF28848.1; JOINED; Genomic_DNA.
DR   EMBL; AF119158; AAF28848.1; JOINED; Genomic_DNA.
DR   EMBL; AF119159; AAF28848.1; JOINED; Genomic_DNA.
DR   EMBL; AF119160; AAF28848.1; JOINED; Genomic_DNA.
DR   EMBL; AF119161; AAF28848.1; JOINED; Genomic_DNA.
DR   EMBL; AF119162; AAF28849.1; -; Genomic_DNA.
DR   EMBL; AF119151; AAF28849.1; JOINED; Genomic_DNA.
DR   EMBL; AF119152; AAF28849.1; JOINED; Genomic_DNA.
DR   EMBL; AF119153; AAF28849.1; JOINED; Genomic_DNA.
DR   EMBL; AF119154; AAF28849.1; JOINED; Genomic_DNA.
DR   EMBL; AF119156; AAF28849.1; JOINED; Genomic_DNA.
DR   EMBL; AF119158; AAF28849.1; JOINED; Genomic_DNA.
DR   EMBL; AF119159; AAF28849.1; JOINED; Genomic_DNA.
DR   EMBL; AF119160; AAF28849.1; JOINED; Genomic_DNA.
DR   EMBL; AF119161; AAF28849.1; JOINED; Genomic_DNA.
DR   EMBL; AF119162; AAF28850.1; -; Genomic_DNA.
DR   EMBL; AF119151; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119152; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119153; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119154; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119155; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119157; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119158; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119159; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119160; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119161; AAF28850.1; JOINED; Genomic_DNA.
DR   EMBL; AF119162; AAF28851.1; -; Genomic_DNA.
DR   EMBL; AF119151; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119152; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119153; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119154; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119156; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119157; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119158; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119159; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119160; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119161; AAF28851.1; JOINED; Genomic_DNA.
DR   EMBL; AF119158; AAF28852.1; -; Genomic_DNA.
DR   EMBL; AF119151; AAF28852.1; JOINED; Genomic_DNA.
DR   EMBL; AF119152; AAF28852.1; JOINED; Genomic_DNA.
DR   EMBL; AF119153; AAF28852.1; JOINED; Genomic_DNA.
DR   EMBL; AF119154; AAF28852.1; JOINED; Genomic_DNA.
DR   EMBL; AF119155; AAF28852.1; JOINED; Genomic_DNA.
DR   EMBL; AF119156; AAF28852.1; JOINED; Genomic_DNA.
DR   EMBL; AF119157; AAF28853.1; -; Genomic_DNA.
DR   EMBL; AF119151; AAF28853.1; JOINED; Genomic_DNA.
DR   EMBL; AF119152; AAF28853.1; JOINED; Genomic_DNA.
DR   EMBL; AF119153; AAF28853.1; JOINED; Genomic_DNA.
DR   EMBL; AF119154; AAF28853.1; JOINED; Genomic_DNA.
DR   EMBL; AF119155; AAF28853.1; JOINED; Genomic_DNA.
DR   EMBL; AF119156; AAF28853.1; JOINED; Genomic_DNA.
DR   CCDS; CCDS4217.1; -. [O14511-1]
DR   PIR; JC5700; JC5700.
DR   RefSeq; NP_001171864.1; NM_001184935.1.
DR   RefSeq; NP_004874.1; NM_004883.2. [O14511-1]
DR   RefSeq; NP_053584.1; NM_013981.3. [O14511-2]
DR   RefSeq; NP_053585.1; NM_013982.2. [O14511-3]
DR   RefSeq; NP_053586.1; NM_013983.2. [O14511-4]
DR   RefSeq; XP_006714873.1; XM_006714810.3. [O14511-6]
DR   UniGene; Hs.408515; -.
DR   ProteinModelPortal; O14511; -.
DR   BioGrid; 114917; 2.
DR   STRING; 9606.ENSP00000354910; -.
DR   iPTMnet; O14511; -.
DR   PhosphoSitePlus; O14511; -.
DR   BioMuta; NRG2; -.
DR   jPOST; O14511; -.
DR   PaxDb; O14511; -.
DR   PeptideAtlas; O14511; -.
DR   PRIDE; O14511; -.
DR   ProteomicsDB; 48047; -.
DR   ProteomicsDB; 48048; -. [O14511-2]
DR   ProteomicsDB; 48049; -. [O14511-3]
DR   ProteomicsDB; 48050; -. [O14511-4]
DR   ProteomicsDB; 48051; -. [O14511-5]
DR   ProteomicsDB; 48052; -. [O14511-6]
DR   ProteomicsDB; 48053; -. [O14511-7]
DR   ProteomicsDB; 48054; -. [O14511-8]
DR   DNASU; 9542; -.
DR   Ensembl; ENST00000289409; ENSP00000289409; ENSG00000158458. [O14511-2]
DR   Ensembl; ENST00000289422; ENSP00000289422; ENSG00000158458. [O14511-3]
DR   Ensembl; ENST00000340391; ENSP00000342660; ENSG00000158458. [O14511-8]
DR   Ensembl; ENST00000358522; ENSP00000351323; ENSG00000158458. [O14511-4]
DR   Ensembl; ENST00000361474; ENSP00000354910; ENSG00000158458. [O14511-1]
DR   Ensembl; ENST00000378238; ENSP00000367483; ENSG00000158458. [O14511-5]
DR   GeneID; 9542; -.
DR   KEGG; hsa:9542; -.
DR   UCSC; uc003lev.3; human. [O14511-1]
DR   CTD; 9542; -.
DR   DisGeNET; 9542; -.
DR   EuPathDB; HostDB:ENSG00000158458.19; -.
DR   GeneCards; NRG2; -.
DR   HGNC; HGNC:7998; NRG2.
DR   HPA; HPA038935; -.
DR   HPA; HPA047973; -.
DR   MIM; 603818; gene.
DR   neXtProt; NX_O14511; -.
DR   OpenTargets; ENSG00000158458; -.
DR   PharmGKB; PA31777; -.
DR   eggNOG; ENOG410IGZW; Eukaryota.
DR   eggNOG; ENOG410Y95Z; LUCA.
DR   GeneTree; ENSGT00940000158778; -.
DR   HOGENOM; HOG000273863; -.
DR   HOVERGEN; HBG006531; -.
DR   InParanoid; O14511; -.
DR   KO; K05456; -.
DR   OMA; ATEHVIR; -.
DR   OrthoDB; 313400at2759; -.
DR   PhylomeDB; O14511; -.
DR   TreeFam; TF332469; -.
DR   Reactome; R-HSA-1227986; Signaling by ERBB2.
DR   Reactome; R-HSA-1236394; Signaling by ERBB4.
DR   Reactome; R-HSA-1250196; SHC1 events in ERBB2 signaling.
DR   Reactome; R-HSA-1250342; PI3K events in ERBB4 signaling.
DR   Reactome; R-HSA-1250347; SHC1 events in ERBB4 signaling.
DR   Reactome; R-HSA-1251985; Nuclear signaling by ERBB4.
DR   Reactome; R-HSA-1257604; PIP3 activates AKT signaling.
DR   Reactome; R-HSA-1306955; GRB7 events in ERBB2 signaling.
DR   Reactome; R-HSA-1358803; Downregulation of ERBB2:ERBB3 signaling.
DR   Reactome; R-HSA-1963640; GRB2 events in ERBB2 signaling.
DR   Reactome; R-HSA-1963642; PI3K events in ERBB2 signaling.
DR   Reactome; R-HSA-2219530; Constitutive Signaling by Aberrant PI3K in Cancer.
DR   Reactome; R-HSA-5673001; RAF/MAP kinase cascade.
DR   Reactome; R-HSA-6785631; ERBB2 Regulates Cell Motility.
DR   Reactome; R-HSA-6811558; PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.
DR   Reactome; R-HSA-8847993; ERBB2 Activates PTK6 Signaling.
DR   Reactome; R-HSA-8863795; Downregulation of ERBB2 signaling.
DR   SignaLink; O14511; -.
DR   SIGNOR; O14511; -.
DR   GeneWiki; NRG2; -.
DR   GenomeRNAi; 9542; -.
DR   PRO; PR:O14511; -.
DR   Proteomes; UP000005640; Chromosome 5.
DR   Bgee; ENSG00000158458; Expressed in 166 organ(s), highest expression level in cerebellar vermis.
DR   ExpressionAtlas; O14511; baseline and differential.
DR   Genevisible; O14511; HS.
DR   GO; GO:0005576; C:extracellular region; TAS:Reactome.
DR   GO; GO:0005615; C:extracellular space; IBA:GO_Central.
DR   GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR   GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
DR   GO; GO:0008083; F:growth factor activity; IEA:UniProtKB-KW.
DR   GO; GO:0046934; F:phosphatidylinositol-4,5-bisphosphate 3-kinase activity; TAS:Reactome.
DR   GO; GO:0004713; F:protein tyrosine kinase activity; TAS:Reactome.
DR   GO; GO:0005088; F:Ras guanyl-nucleotide exchange factor activity; TAS:Reactome.
DR   GO; GO:0005102; F:signaling receptor binding; IBA:GO_Central.
DR   GO; GO:0038128; P:ERBB2 signaling pathway; TAS:Reactome.
DR   GO; GO:0035556; P:intracellular signal transduction; IBA:GO_Central.
DR   GO; GO:0000165; P:MAPK cascade; TAS:Reactome.
DR   GO; GO:0007399; P:nervous system development; IEA:InterPro.
DR   GO; GO:0051897; P:positive regulation of protein kinase B signaling; TAS:Reactome.
DR   GO; GO:2000145; P:regulation of cell motility; TAS:Reactome.
DR   GO; GO:0007165; P:signal transduction; TAS:ProtInc.
DR   Gene3D; 2.60.40.10; -; 1.
DR   InterPro; IPR013032; EGF-like_CS.
DR   InterPro; IPR000742; EGF-like_dom.
DR   InterPro; IPR007110; Ig-like_dom.
DR   InterPro; IPR036179; Ig-like_dom_sf.
DR   InterPro; IPR013783; Ig-like_fold.
DR   InterPro; IPR013098; Ig_I-set.
DR   InterPro; IPR003599; Ig_sub.
DR   InterPro; IPR003598; Ig_sub2.
DR   InterPro; IPR040180; Neuregulin.
DR   InterPro; IPR002154; Neuregulin_C.
DR   PANTHER; PTHR11100; PTHR11100; 1.
DR   Pfam; PF07679; I-set; 1.
DR   Pfam; PF02158; Neuregulin; 1.
DR   SMART; SM00409; IG; 1.
DR   SMART; SM00408; IGc2; 1.
DR   SUPFAM; SSF48726; SSF48726; 1.
DR   PROSITE; PS00022; EGF_1; 1.
DR   PROSITE; PS01186; EGF_2; 1.
DR   PROSITE; PS50026; EGF_3; 1.
DR   PROSITE; PS50835; IG_LIKE; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; Cell membrane; Complete proteome;
KW   Disulfide bond; EGF-like domain; Glycoprotein; Growth factor;
KW   Immunoglobulin domain; Membrane; Reference proteome; Secreted;
KW   Transmembrane; Transmembrane helix.
FT   PROPEP        1    111       {ECO:0000250}.
FT                                /FTId=PRO_0000019472.
FT   CHAIN       112    850       Pro-neuregulin-2, membrane-bound isoform.
FT                                /FTId=PRO_0000019473.
FT   CHAIN       112    404       Neuregulin-2.
FT                                /FTId=PRO_0000019474.
FT   TOPO_DOM    112    405       Extracellular. {ECO:0000255}.
FT   TRANSMEM    406    426       Helical; Note=Internal signal sequence.
FT                                {ECO:0000255}.
FT   TOPO_DOM    427    850       Cytoplasmic. {ECO:0000255}.
FT   DOMAIN      237    332       Ig-like C2-type.
FT   DOMAIN      341    382       EGF-like. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00076}.
FT   COMPBIAS     10     13       Poly-Pro.
FT   COMPBIAS     20     30       Poly-Ser.
FT   COMPBIAS     33     47       Poly-Ser.
FT   COMPBIAS     87     90       Poly-Ala.
FT   COMPBIAS    330    340       Ser/Thr-rich.
FT   COMPBIAS    721    727       Poly-Pro.
FT   CARBOHYD     52     52       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD     53     53       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    147    147       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    278    278       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    346    346       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   DISULFID    257    311       {ECO:0000250}.
FT   DISULFID    345    359       {ECO:0000250}.
FT   DISULFID    353    370       {ECO:0000250}.
FT   DISULFID    372    381       {ECO:0000250}.
FT   VAR_SEQ       1    241       Missing (in isoform DON-1B).
FT                                {ECO:0000303|PubMed:9199335}.
FT                                /FTId=VSP_003452.
FT   VAR_SEQ       1    233       MRQVCCSALPPPPLEKGRCSSYSDSSSSSSERSSSSSSSSS
FT                                ESGSSSRSSSNNSSISRPAAPPEPRPQQQPQPRSPAARRAA
FT                                ARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQ
FT                                AYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVL
FT                                DKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPL
FT                                VFKTAFAPLDTNGKNLKKEVGKILCTDC -> MSESRRRGR
FT                                GRGKKHPEGRKREREPDPGEK (in isoform DON-
FT                                1R). {ECO:0000303|PubMed:9199335}.
FT                                /FTId=VSP_003451.
FT   VAR_SEQ     374    397       NGFFGQRCLEKLPLRLYMPDPKQK -> VGYTGDRCQQFAM
FT                                VNFSKHLGFELKE (in isoform 4).
FT                                {ECO:0000305}.
FT                                /FTId=VSP_003454.
FT   VAR_SEQ     374    396       NGFFGQRCLEKLPLRLYMPDPKQ -> VGYTGDRCQQFAMV
FT                                NFS (in isoform 2). {ECO:0000305}.
FT                                /FTId=VSP_003453.
FT   VAR_SEQ     397    426       KAEELYQKRVLTITGICVALLVVGIVCVVA -> SVLWDTP
FT                                GTGVSSSQWSTSPKPRSCTRRGS (in isoform 5).
FT                                {ECO:0000305}.
FT                                /FTId=VSP_003458.
FT   VAR_SEQ     397    422       KAEELYQKRVLTITGICVALLVVGIV -> SVLWDTPGTGV
FT                                SSSQWSTSPSTLDLN (in isoform 6).
FT                                {ECO:0000305}.
FT                                /FTId=VSP_003456.
FT   VAR_SEQ     397    397       K -> KHLGFELKE (in isoform 3 and isoform
FT                                DON-1B). {ECO:0000303|PubMed:9199335}.
FT                                /FTId=VSP_003455.
FT   VAR_SEQ     423    850       Missing (in isoform 6). {ECO:0000305}.
FT                                /FTId=VSP_003457.
FT   VAR_SEQ     427    850       Missing (in isoform 5). {ECO:0000305}.
FT                                /FTId=VSP_003459.
SQ   SEQUENCE   850 AA;  91679 MW;  7124C089435FD2F4 CRC64;
     MRQVCCSALP PPPLEKGRCS SYSDSSSSSS ERSSSSSSSS SESGSSSRSS SNNSSISRPA
     APPEPRPQQQ PQPRSPAARR AAARSRAAAA GGMRRDPAPG FSMLLFGVSL ACYSPSLKSV
     QDQAYKAPVV VEGKVQGLVP AGGSSSNSTR EPPASGRVAL VKVLDKWPLR SGGLQREQVI
     SVGSCVPLER NQRYIFFLEP TEQPLVFKTA FAPLDTNGKN LKKEVGKILC TDCATRPKLK
     KMKSQTGQVG EKQSLKCEAA AGNPQPSYRW FKDGKELNRS RDIRIKYGNG RKNSRLQFNK
     VKVEDAGEYV CEAENILGKD TVRGRLYVNS VSTTLSSWSG HARKCNETAK SYCVNGGVCY
     YIEGINQLSC KCPNGFFGQR CLEKLPLRLY MPDPKQKAEE LYQKRVLTIT GICVALLVVG
     IVCVVAYCKT KKQRKQMHNH LRQNMCPAHQ NRSLANGPSH PRLDPEEIQM ADYISKNVPA
     TDHVIRRETE TTFSGSHSCS PSHHCSTATP TSSHRHESHT WSLERSESLT SDSQSGIMLS
     SVGTSKCNSP ACVEARARRA AAYNLEERRR ATAPPYHDSV DSLRDSPHSE RYVSALTTPA
     RLSPVDFHYS LATQVPTFEI TSPNSAHAVS LPPAAPISYR LAEQQPLLRH PAPPGPGPGP
     GPGPGPGADM QRSYDSYYYP AAGPGPRRGT CALGGSLGSL PASPFRIPED DEYETTQECA
     PPPPPRPRAR GASRRTSAGP RRWRRSRLNG LAAQRARAAR DSLSLSSGSG GGSASASDDD
     ADDADGALAA ESTPFLGLRG AHDALRSDSP PLCPAADSRT YYSLDSHSTR ASSRHSRGPP
     PRAKQDSAPL
//
DBGET integrated database retrieval system