GenomeNet

Database: UniProt
Entry: O95965
LinkDB: O95965
Original site: O95965 
ID   ITGBL_HUMAN             Reviewed;         494 AA.
AC   O95965; A8K5M5; B3KTP1; B4DQ02; Q8N172; Q9NPR0;
DT   18-MAR-2008, integrated into UniProtKB/Swiss-Prot.
DT   01-MAY-1999, sequence version 1.
DT   10-APR-2019, entry version 163.
DE   RecName: Full=Integrin beta-like protein 1;
DE   AltName: Full=Osteoblast-specific cysteine-rich protein;
DE   AltName: Full=Ten integrin EGF-like repeat domain-containing protein;
DE   Flags: Precursor;
GN   Name=ITGBL1; Synonyms=OSCP, TIED;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND TISSUE SPECIFICITY.
RC   TISSUE=Umbilical vein;
RX   PubMed=10051402; DOI=10.1006/geno.1998.5707;
RA   Berg R.W., Leung E., Gough S., Morris C., Yao W.P., Wang S.X., Ni J.,
RA   Krissansen G.W.;
RT   "Cloning and characterization of a novel beta integrin-related cDNA
RT   coding for the protein TIED ('ten beta integrin EGF-like repeat
RT   domains') that maps to chromosome band 13q33: a divergent stand-alone
RT   integrin stalk structure.";
RL   Genomics 56:169-178(1999).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
RC   TISSUE=Tongue;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA].
RX   PubMed=12364586; DOI=10.1073/pnas.182412499;
RA   Chumakov I., Blumenfeld M., Guerassimenko O., Cavarec L., Palicio M.,
RA   Abderrahim H., Bougueleret L., Barry C., Tanaka H., La Rosa P.,
RA   Puech A., Tahri N., Cohen-Akenine A., Delabrosse S., Lissarrague S.,
RA   Picard F.-P., Maurice K., Essioux L., Millasseau P., Grel P.,
RA   Debailleul V., Simon A.-M., Caterina D., Dufaure I., Malekzadeh K.,
RA   Belova M., Luan J.-J., Bouillot M., Sambucy J.-L., Primas G.,
RA   Saumier M., Boubkiri N., Martin-Saumier S., Nasroune M., Peixoto H.,
RA   Delaye A., Pinchot V., Bastucci M., Guillou S., Chevillon M.,
RA   Sainz-Fuertes R., Meguenni S., Aurich-Costa J., Cherif D., Gimalac A.,
RA   Van Duijn C., Gauvreau D., Ouellette G., Fortier I., Raelson J.,
RA   Sherbatich T., Riazanskay N., Rogaev E., Raeymaekers P., Aerssens J.,
RA   Konings F., Luyten W., Macciardi F., Sham P.C., Straub R.E.,
RA   Weinberger D.R., Cohen N., Cohen D.;
RT   "Genetic and physiological data implicating the new human gene G72 and
RT   the gene for D-amino acid oxidase in schizophrenia.";
RL   Proc. Natl. Acad. Sci. U.S.A. 99:13675-13680(2002).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15057823; DOI=10.1038/nature02379;
RA   Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L.,
RA   Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E.,
RA   Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.,
RA   Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R.,
RA   Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S.,
RA   Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P.,
RA   Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M.,
RA   Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J.,
RA   Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E.,
RA   Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L.,
RA   Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J.,
RA   Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S.,
RA   Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J.,
RA   Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M.,
RA   King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A.,
RA   Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S.,
RA   Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S.,
RA   Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I.,
RA   Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S.,
RA   Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A.,
RA   Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B.,
RA   Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L.,
RA   Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M.,
RA   Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.;
RT   "The DNA sequence and analysis of human chromosome 13.";
RL   Nature 428:522-528(2004).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
RC   TISSUE=Brain;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [7]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 383-494.
RG   The European IMAGE consortium;
RL   Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases.
CC   -!- SUBCELLULAR LOCATION: Secreted {ECO:0000305}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=3;
CC       Name=1;
CC         IsoId=O95965-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=O95965-2; Sequence=VSP_054799;
CC         Note=No experimental confirmation available.;
CC       Name=3;
CC         IsoId=O95965-3; Sequence=VSP_054800;
CC         Note=No experimental confirmation available.;
CC   -!- TISSUE SPECIFICITY: Widely expressed in many tissues, but readily
CC       detectable only in aorta. {ECO:0000269|PubMed:10051402}.
CC   -!- DOMAIN: Contains ten tandem EGF-like repeats strikingly similar to
CC       those found in the cysteine rich 'stalk-like' structure of
CC       integrin beta-subunits.
DR   EMBL; AF072752; AAD17666.1; -; mRNA.
DR   EMBL; AK095875; BAG53153.1; -; mRNA.
DR   EMBL; AK291340; BAF84029.1; -; mRNA.
DR   EMBL; AK298571; BAG60764.1; -; mRNA.
DR   EMBL; AE014293; AAN16024.1; -; Genomic_DNA.
DR   EMBL; AL139800; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL160153; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL355807; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471085; EAX09052.1; -; Genomic_DNA.
DR   EMBL; BC036788; AAH36788.2; -; mRNA.
DR   EMBL; AL359052; CAB94388.1; -; mRNA.
DR   CCDS; CCDS61361.1; -. [O95965-3]
DR   CCDS; CCDS61362.1; -. [O95965-2]
DR   CCDS; CCDS9499.1; -. [O95965-1]
DR   RefSeq; NP_001258683.1; NM_001271754.1. [O95965-2]
DR   RefSeq; NP_001258684.1; NM_001271755.1.
DR   RefSeq; NP_001258685.1; NM_001271756.1. [O95965-3]
DR   RefSeq; NP_004782.1; NM_004791.2. [O95965-1]
DR   RefSeq; XP_005254157.1; XM_005254100.4. [O95965-1]
DR   UniGene; Hs.696554; -.
DR   ProteinModelPortal; O95965; -.
DR   SMR; O95965; -.
DR   STRING; 9606.ENSP00000365351; -.
DR   iPTMnet; O95965; -.
DR   PhosphoSitePlus; O95965; -.
DR   BioMuta; ITGBL1; -.
DR   jPOST; O95965; -.
DR   MaxQB; O95965; -.
DR   PaxDb; O95965; -.
DR   PeptideAtlas; O95965; -.
DR   PRIDE; O95965; -.
DR   ProteomicsDB; 51147; -.
DR   TopDownProteomics; O95965-1; -. [O95965-1]
DR   Ensembl; ENST00000376162; ENSP00000365332; ENSG00000198542. [O95965-3]
DR   Ensembl; ENST00000376180; ENSP00000365351; ENSG00000198542. [O95965-1]
DR   Ensembl; ENST00000545560; ENSP00000439903; ENSG00000198542. [O95965-2]
DR   GeneID; 9358; -.
DR   KEGG; hsa:9358; -.
DR   UCSC; uc001vpb.5; human. [O95965-1]
DR   CTD; 9358; -.
DR   DisGeNET; 9358; -.
DR   EuPathDB; HostDB:ENSG00000198542.13; -.
DR   GeneCards; ITGBL1; -.
DR   H-InvDB; HIX0011436; -.
DR   HGNC; HGNC:6164; ITGBL1.
DR   HPA; HPA005676; -.
DR   MIM; 604234; gene.
DR   neXtProt; NX_O95965; -.
DR   OpenTargets; ENSG00000198542; -.
DR   PharmGKB; PA29963; -.
DR   eggNOG; KOG1226; Eukaryota.
DR   eggNOG; ENOG410XP60; LUCA.
DR   GeneTree; ENSGT00950000182617; -.
DR   HOGENOM; HOG000113115; -.
DR   HOVERGEN; HBG052797; -.
DR   InParanoid; O95965; -.
DR   OMA; CQYPTHC; -.
DR   OrthoDB; 18592at2759; -.
DR   PhylomeDB; O95965; -.
DR   TreeFam; TF332636; -.
DR   Reactome; R-HSA-8941332; RUNX2 regulates genes involved in cell migration.
DR   GenomeRNAi; 9358; -.
DR   PRO; PR:O95965; -.
DR   Proteomes; UP000005640; Chromosome 13.
DR   Bgee; ENSG00000198542; Expressed in 206 organ(s), highest expression level in tendon.
DR   ExpressionAtlas; O95965; baseline and differential.
DR   Genevisible; O95965; HS.
DR   GO; GO:0009986; C:cell surface; IBA:GO_Central.
DR   GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
DR   GO; GO:0005925; C:focal adhesion; IBA:GO_Central.
DR   GO; GO:0008305; C:integrin complex; IBA:GO_Central.
DR   GO; GO:0005886; C:plasma membrane; TAS:Reactome.
DR   GO; GO:0005178; F:integrin binding; IBA:GO_Central.
DR   GO; GO:0007155; P:cell adhesion; TAS:ProtInc.
DR   GO; GO:0033627; P:cell adhesion mediated by integrin; IBA:GO_Central.
DR   GO; GO:0016477; P:cell migration; IBA:GO_Central.
DR   GO; GO:0007160; P:cell-matrix adhesion; IBA:GO_Central.
DR   GO; GO:0007229; P:integrin-mediated signaling pathway; IBA:GO_Central.
DR   InterPro; IPR000742; EGF-like_dom.
DR   InterPro; IPR013111; EGF_extracell.
DR   InterPro; IPR027070; Integrin_b-like_p1.
DR   InterPro; IPR015812; Integrin_bsu.
DR   PANTHER; PTHR10082; PTHR10082; 1.
DR   PANTHER; PTHR10082:SF3; PTHR10082:SF3; 1.
DR   Pfam; PF07974; EGF_2; 4.
DR   SMART; SM00181; EGF; 6.
DR   PROSITE; PS00022; EGF_1; 5.
DR   PROSITE; PS01186; EGF_2; 5.
DR   PROSITE; PS00243; INTEGRIN_BETA; 10.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Complete proteome; EGF-like domain;
KW   Glycoprotein; Polymorphism; Reference proteome; Repeat; Secreted;
KW   Signal.
FT   SIGNAL        1     23       {ECO:0000255}.
FT   CHAIN        24    494       Integrin beta-like protein 1.
FT                                /FTId=PRO_5000054386.
FT   REPEAT       51     95       I.
FT   REPEAT       96    142       II.
FT   REPEAT      143    184       III.
FT   REPEAT      185    230       IV.
FT   REPEAT      231    275       V.
FT   REPEAT      276    326       VI.
FT   REPEAT      327    367       VII.
FT   REPEAT      368    414       VIII.
FT   REPEAT      415    454       IX.
FT   REPEAT      455    494       X.
FT   REGION       51    494       Cysteine-rich tandem repeats.
FT   CARBOHYD    405    405       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   VAR_SEQ       1    141       Missing (in isoform 2).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_054799.
FT   VAR_SEQ       1    105       MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACR
FT                                LSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPG
FT                                MFFGPLCECHEWVCETYDGSTCA -> MNLVAVMGAFNK
FT                                (in isoform 3).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_054800.
FT   VARIANT     154    154       A -> S (in dbSNP:rs1140605).
FT                                /FTId=VAR_039542.
FT   CONFLICT      3      3       P -> S (in Ref. 2; BAF84029).
FT                                {ECO:0000305}.
FT   CONFLICT    453    453       R -> G (in Ref. 2; BAF84029).
FT                                {ECO:0000305}.
SQ   SEQUENCE   494 AA;  53921 MW;  72E095D0BD4ECFF3 CRC64;
     MRPPGFRNFL LLASSLLFAG LSAVPQSFSP SLRSWPGAAC RLSRAESERR CRAPGQPPGA
     ALCHGRGRCD CGVCICHVTE PGMFFGPLCE CHEWVCETYD GSTCAGHGKC DCGKCKCDQG
     WYGDACQYPT NCDLTKKKSN QMCKNSQDII CSNAGTCHCG RCKCDNSDGS GLVYGKFCEC
     DDRECIDDET EEICGGHGKC YCGNCYCKAG WHGDKCEFQC DITPWESKRR CTSPDGKICS
     NRGTCVCGEC TCHDVDPTGD WGDIHGDTCE CDERDCRAVY DRYSDDFCSG HGQCNCGRCD
     CKAGWYGKKC EHPQSCTLSA EESIRKCQGS SDLPCSGRGK CECGKCTCYP PGDRRVYGKT
     CECDDRRCED LDGVVCGGHG TCSCGRCVCE RGWFGKLCQH PRKCNMTEEQ SKNLCESADG
     ILCSGKGSCH CGKCICSAEE WYISGEFCDC DDRDCDKHDG LICTGNGICS CGNCECWDGW
     NGNACEIWLG SEYP
//
DBGET integrated database retrieval system