GenomeNet

Database: UniProt
Entry: P04808
LinkDB: P04808
Original site: P04808 
ID   REL1_HUMAN              Reviewed;         185 AA.
AC   P04808; Q99936; Q9UQJ1;
DT   13-AUG-1987, integrated into UniProtKB/Swiss-Prot.
DT   13-AUG-1987, sequence version 1.
DT   08-MAY-2019, entry version 176.
DE   RecName: Full=Prorelaxin H1;
DE   Contains:
DE     RecName: Full=Relaxin B chain;
DE   Contains:
DE     RecName: Full=Relaxin A chain;
DE   Flags: Precursor;
GN   Name=RLN1;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
RX   PubMed=6548702;
RA   Hudson P., John M., Crawford R., Haralambidis J., Scanlon D.,
RA   Gorman J., Tregear G., Shine J., Niall H.;
RT   "Relaxin gene expression in human ovaries and the predicted structure
RT   of a human preprorelaxin by analysis of cDNA clones.";
RL   EMBO J. 3:2333-2339(1984).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA].
RX   PubMed=6298628; DOI=10.1038/301628a0;
RA   Hudson P., Haley J., John M., Cronk M., Crawford R., Haralambidis J.,
RA   Tregear G., Shine J., Niall H.;
RT   "Structure of a genomic clone encoding biologically active human
RT   relaxin.";
RL   Nature 301:628-631(1983).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15164053; DOI=10.1038/nature02465;
RA   Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
RA   Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
RA   Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
RA   Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
RA   Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
RA   Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
RA   Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
RA   Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
RA   Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
RA   Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
RA   Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
RA   Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
RA   Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
RA   Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
RA   Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
RA   Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
RA   Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
RA   Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
RA   McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
RA   Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
RA   Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
RA   Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
RA   Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
RA   Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
RA   Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
RA   Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
RA   Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
RA   Rogers J., Dunham I.;
RT   "DNA sequence and analysis of human chromosome 9.";
RL   Nature 429:369-374(2004).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
RC   TISSUE=Prostate;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [5]
RP   PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING, AND
RP   TISSUE SPECIFICITY.
RC   TISSUE=Prostate;
RX   PubMed=8735594; DOI=10.1016/0303-7207(96)03770-7;
RA   Gunnersen J.M., Fu P., Roche P.J., Tregear G.W.;
RT   "Expression of human relaxin genes: characterization of a novel
RT   alternatively-spliced human relaxin mRNA species.";
RL   Mol. Cell. Endocrinol. 118:85-94(1996).
RN   [6]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-11.
RX   PubMed=10601981; DOI=10.1677/jme.0.0230355;
RA   Garibay-Tupas J.L., Csiszar K., Fox M., Povey S.,
RA   Bryant-Greenwood G.D.;
RT   "Analysis of the 5'-upstream regions of the human relaxin H1 and H2
RT   genes and their chromosomal localization on chromosome 9p24.1 by
RT   radiation hybrid and breakpoint mapping.";
RL   J. Mol. Endocrinol. 23:355-365(1999).
CC   -!- FUNCTION: Relaxin is an ovarian hormone that acts with estrogen to
CC       produce dilatation of the birth canal in many mammals. May be
CC       involved in remodeling of connective tissues during pregnancy,
CC       promoting growth of pubic ligaments and ripening of the cervix.
CC   -!- SUBUNIT: Heterodimer of a B chain and an A chain linked by two
CC       disulfide bonds.
CC   -!- SUBCELLULAR LOCATION: Secreted.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=P04808-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=P04808-2; Sequence=VSP_002709, VSP_002710;
CC   -!- TISSUE SPECIFICITY: Prostate. Not expressed in placenta, decidua
CC       or ovary. {ECO:0000269|PubMed:8735594}.
CC   -!- SIMILARITY: Belongs to the insulin family. {ECO:0000305}.
DR   EMBL; X00949; CAA25461.1; -; mRNA.
DR   EMBL; V00578; CAA23839.1; -; Genomic_DNA.
DR   EMBL; V00577; CAA23838.1; -; Genomic_DNA.
DR   EMBL; AL135786; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BC005956; AAH05956.1; -; mRNA.
DR   EMBL; S83200; AAD14429.1; -; Genomic_DNA.
DR   EMBL; AF104934; AAD21967.1; -; Genomic_DNA.
DR   CCDS; CCDS6462.1; -. [P04808-1]
DR   PIR; B05092; A44559.
DR   RefSeq; NP_008842.1; NM_006911.3. [P04808-1]
DR   RefSeq; XP_016870498.1; XM_017015009.1. [P04808-2]
DR   SMR; P04808; -.
DR   BioGrid; 111945; 82.
DR   IntAct; P04808; 2.
DR   STRING; 9606.ENSP00000223862; -.
DR   iPTMnet; P04808; -.
DR   PhosphoSitePlus; P04808; -.
DR   BioMuta; RLN1; -.
DR   DMDM; 132280; -.
DR   jPOST; P04808; -.
DR   PaxDb; P04808; -.
DR   PeptideAtlas; P04808; -.
DR   PRIDE; P04808; -.
DR   ProteomicsDB; 51745; -.
DR   ProteomicsDB; 51746; -. [P04808-2]
DR   DNASU; 6013; -.
DR   Ensembl; ENST00000223862; ENSP00000223862; ENSG00000107018. [P04808-1]
DR   GeneID; 6013; -.
DR   KEGG; hsa:6013; -.
DR   UCSC; uc003zjb.3; human. [P04808-1]
DR   CTD; 6013; -.
DR   DisGeNET; 6013; -.
DR   GeneCards; RLN1; -.
DR   HGNC; HGNC:10026; RLN1.
DR   MIM; 179730; gene.
DR   neXtProt; NX_P04808; -.
DR   OpenTargets; ENSG00000107018; -.
DR   PharmGKB; PA34399; -.
DR   eggNOG; ENOG410J1BP; Eukaryota.
DR   eggNOG; ENOG411169Y; LUCA.
DR   GeneTree; ENSGT00940000154434; -.
DR   HOGENOM; HOG000236342; -.
DR   InParanoid; P04808; -.
DR   KO; K21998; -.
DR   OMA; EKCCLIG; -.
DR   OrthoDB; 1331287at2759; -.
DR   PhylomeDB; P04808; -.
DR   TreeFam; TF333404; -.
DR   GenomeRNAi; 6013; -.
DR   PRO; PR:P04808; -.
DR   Proteomes; UP000005640; Chromosome 9.
DR   Bgee; ENSG00000107018; Expressed in 71 organ(s), highest expression level in prostate gland.
DR   Genevisible; P04808; HS.
DR   GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
DR   GO; GO:0005179; F:hormone activity; TAS:ProtInc.
DR   GO; GO:0007565; P:female pregnancy; NAS:ProtInc.
DR   GO; GO:0007165; P:signal transduction; NAS:ProtInc.
DR   InterPro; IPR016179; Insulin-like.
DR   InterPro; IPR036438; Insulin-like_sf.
DR   InterPro; IPR022353; Insulin_CS.
DR   InterPro; IPR022352; Insulin_family.
DR   InterPro; IPR022421; Relaxin.
DR   Pfam; PF00049; Insulin; 1.
DR   PRINTS; PR00276; INSULINFAMLY.
DR   PRINTS; PR02004; RELAXIN.
DR   SMART; SM00078; IlGF; 1.
DR   SUPFAM; SSF56994; SSF56994; 1.
DR   PROSITE; PS00262; INSULIN; 1.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Cleavage on pair of basic residues;
KW   Complete proteome; Disulfide bond; Hormone; Polymorphism;
KW   Reference proteome; Secreted; Signal.
FT   SIGNAL        1     22       {ECO:0000250}.
FT   PEPTIDE      23     53       Relaxin B chain. {ECO:0000250}.
FT                                /FTId=PRO_0000016076.
FT   PROPEP       56    158       Connecting peptide. {ECO:0000250}.
FT                                /FTId=PRO_0000016077.
FT   PEPTIDE     163    185       Relaxin A chain. {ECO:0000250}.
FT                                /FTId=PRO_0000016078.
FT   DISULFID     35    172       Interchain (between B and A chains).
FT                                {ECO:0000250}.
FT   DISULFID     47    185       Interchain (between B and A chains).
FT                                {ECO:0000250}.
FT   DISULFID    171    176       {ECO:0000250}.
FT   VAR_SEQ      71    117       EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPE
FT                                LQQYVP -> GDFIQTVSLGISPDGGKALRTGSCFTREFLG
FT                                ALSKLYHPSSTKIQKL (in isoform 2).
FT                                {ECO:0000305}.
FT                                /FTId=VSP_002709.
FT   VAR_SEQ     118    185       Missing (in isoform 2). {ECO:0000305}.
FT                                /FTId=VSP_002710.
FT   VARIANT      28     28       K -> M (in dbSNP:rs397780021).
FT                                /FTId=VAR_011962.
SQ   SEQUENCE   185 AA;  21146 MW;  B318628ABFEC7142 CRC64;
     MPRLFLFHLL EFCLLLNQFS RAVAAKWKDD VIKLCGRELV RAQIAICGMS TWSKRSLSQE
     DAPQTPRPVA EIVPSFINKD TETIIIMLEF IANLPPELKA ALSERQPSLP ELQQYVPALK
     DSNLSFEEFK KLIRNRQSEA ADSNPSELKY LGLDTHSQKK RRPYVALFEK CCLIGCTKRS
     LAKYC
//
DBGET integrated database retrieval system