GenomeNet

Database: UniProt
Entry: P51023
LinkDB: P51023
Original site: P51023 
ID   PNT_DROME               Reviewed;         718 AA.
AC   P51023; A0A0B4KH96; B9EQV8; H8F4R1; P19420; P51022; Q29R53; Q8IG92; Q8IMZ1;
AC   Q9VCN2;
DT   01-OCT-1996, integrated into UniProtKB/Swiss-Prot.
DT   16-NOV-2001, sequence version 2.
DT   07-OCT-2020, entry version 193.
DE   RecName: Full=ETS-like protein pointed {ECO:0000305};
GN   Name=pnt {ECO:0000312|FlyBase:FBgn0003118};
GN   Synonyms=DMPOINT1A {ECO:0000312|FlyBase:FBgn0003118},
GN   ETS2 {ECO:0000312|FlyBase:FBgn0003118},
GN   Ets58AB {ECO:0000303|PubMed:2834248},
GN   pointed {ECO:0000312|FlyBase:FBgn0003118}; ORFNames=CG17077;
OS   Drosophila melanogaster (Fruit fly).
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Holometabola; Diptera; Brachycera; Muscomorpha; Ephydroidea;
OC   Drosophilidae; Drosophila; Sophophora.
OX   NCBI_TaxID=7227 {ECO:0000312|Proteomes:UP000000803};
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS P1 AND P2), FUNCTION, DEVELOPMENTAL
RP   STAGE, DISRUPTION PHENOTYPE, AND DOMAIN ETS.
RX   PubMed=8223245;
RA   Klaembt C.;
RT   "The Drosophila gene pointed encodes two ETS-like proteins which are
RT   involved in the development of the midline glial cells.";
RL   Development 117:163-176(1993).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=Berkeley {ECO:0000312|Proteomes:UP000000803};
RX   PubMed=10731132; DOI=10.1126/science.287.5461.2185;
RA   Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
RA   Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
RA   George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
RA   Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X., Brandon R.C.,
RA   Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C.,
RA   Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A.,
RA   An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A.,
RA   Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V.,
RA   Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J.,
RA   Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E.,
RA   Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B.,
RA   Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I.,
RA   Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C.,
RA   Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S.,
RA   Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M.,
RA   Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
RA   Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D.,
RA   Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F.,
RA   Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D.,
RA   Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A.,
RA   Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C.,
RA   McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C.,
RA   Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L.,
RA   Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R.,
RA   Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V.,
RA   Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F.,
RA   Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
RA   Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R.,
RA   Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y.,
RA   Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T.,
RA   Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S.,
RA   Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W.,
RA   Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M.,
RA   Venter J.C.;
RT   "The genome sequence of Drosophila melanogaster.";
RL   Science 287:2185-2195(2000).
RN   [3]
RP   GENOME REANNOTATION.
RC   STRAIN=Berkeley {ECO:0000312|Proteomes:UP000000803};
RX   PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
RA   Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
RA   Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
RA   Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
RA   Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
RA   Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q., Stapleton M.,
RA   Yamada C., Ashburner M., Gelbart W.M., Rubin G.M., Lewis S.E.;
RT   "Annotation of the Drosophila melanogaster euchromatic genome: a systematic
RT   review.";
RL   Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS D AND P2).
RC   STRAIN=Berkeley {ECO:0000312|EMBL:ABC86249.1};
RC   TISSUE=Embryo {ECO:0000312|EMBL:ACM16754.1};
RA   Stapleton M., Booth B., Kapadia B., Carlson J., Chavez C., Frise E.,
RA   George R., Pacleb J., Park S., Wan K., Yu C., Celniker S.;
RL   Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases.
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-323 (ISOFORM P2).
RC   STRAIN=Berkeley {ECO:0000312|EMBL:AAN71682.1}; TISSUE=Embryo;
RX   PubMed=12537569; DOI=10.1186/gb-2002-3-12-research0080;
RA   Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A.,
RA   Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M.,
RA   Celniker S.E.;
RT   "A Drosophila full-length cDNA resource.";
RL   Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002).
RN   [6]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 540-698, AND DEVELOPMENTAL STAGE.
RX   PubMed=2834248; DOI=10.1016/0012-1606(88)90187-x;
RA   Pribyl L.J., Watson D.K., McWilliams M.J., Ascione R., Papas T.S.;
RT   "The Drosophila ets-2 gene: molecular structure, chromosomal localization,
RT   and developmental expression.";
RL   Dev. Biol. 127:45-53(1988).
RN   [7]
RP   NUCLEOTIDE SEQUENCE [MRNA] OF 551-708 (ISOFORM P2), DEVELOPMENTAL STAGE,
RP   AND DOMAIN ETS.
RC   STRAIN=Canton-S {ECO:0000312|EMBL:AAC34200.1};
RC   TISSUE=Larva {ECO:0000312|EMBL:AAC34200.1};
RX   PubMed=1577186; DOI=10.1016/0012-1606(92)90225-6;
RA   Chen T., Bunting M., Karim F.D., Thummel C.S.;
RT   "Isolation and characterization of five Drosophila genes that encode an
RT   ets-related DNA binding domain.";
RL   Dev. Biol. 151:176-191(1992).
RN   [8]
RP   FUNCTION, DEVELOPMENTAL STAGE, PHOSPHORYLATION AT THR-151, DISRUPTION
RP   PHENOTYPE, AND MUTAGENESIS OF THR-151.
RX   PubMed=8033205; DOI=10.1016/0092-8674(94)90580-0;
RA   O'Neill E.M., Rebay I., Tjian R., Rubin G.M.;
RT   "The activities of two Ets-related transcription factors required for
RT   Drosophila eye development are modulated by the Ras/MAPK pathway.";
RL   Cell 78:137-147(1994).
RN   [9]
RP   FUNCTION, SUBCELLULAR LOCATION, AND DEVELOPMENTAL STAGE.
RX   PubMed=22143802; DOI=10.1073/pnas.1118595109;
RA   Zhu S., Barshow S., Wildonger J., Jan L.Y., Jan Y.N.;
RT   "Ets transcription factor Pointed promotes the generation of intermediate
RT   neural progenitors in Drosophila larval brains.";
RL   Proc. Natl. Acad. Sci. U.S.A. 108:20615-20620(2011).
RN   [10]
RP   FUNCTION, DEVELOPMENTAL STAGE, AND DISRUPTION PHENOTYPE.
RX   PubMed=23757412; DOI=10.1242/dev.093138;
RA   Shwartz A., Yogev S., Schejter E.D., Shilo B.Z.;
RT   "Sequential activation of ETS proteins provides a sustained transcriptional
RT   response to EGFR signaling.";
RL   Development 140:2746-2754(2013).
RN   [11]
RP   FUNCTION, DEVELOPMENTAL STAGE, AND DISRUPTION PHENOTYPE.
RX   PubMed=27151950; DOI=10.1242/dev.136184;
RA   Li X., Xie Y., Zhu S.;
RT   "Notch maintains Drosophila type II neuroblasts by suppressing expression
RT   of the Fez transcription factor Earmuff.";
RL   Development 143:2511-2521(2016).
RN   [12]
RP   FUNCTION, AND DISRUPTION PHENOTYPE.
RX   PubMed=27510969; DOI=10.1242/dev.137281;
RA   Xie Y., Li X., Deng X., Hou Y., O'Hara K., Urso A., Peng Y., Chen L.,
RA   Zhu S.;
RT   "The Ets protein Pointed prevents both premature differentiation and
RT   dedifferentiation of Drosophila intermediate neural progenitors.";
RL   Development 143:3109-3118(2016).
RN   [13]
RP   FUNCTION, AND DISRUPTION PHENOTYPE.
RX   PubMed=28899667; DOI=10.1016/j.ydbio.2017.09.011;
RA   Li X., Chen R., Zhu S.;
RT   "bHLH-O proteins balance the self-renewal and differentiation of Drosophila
RT   neural stem cells by regulating Earmuff expression.";
RL   Dev. Biol. 431:239-251(2017).
RN   [14]
RP   FUNCTION, DEVELOPMENTAL STAGE, AND DOMAIN ETS.
RX   PubMed=28245922; DOI=10.1016/j.devcel.2017.01.014;
RA   Janssens D.H., Hamm D.C., Anhezini L., Xiao Q., Siller K.H., Siegrist S.E.,
RA   Harrison M.M., Lee C.Y.;
RT   "An Hdac1/Rpd3-poised circuit balances continual self-renewal and rapid
RT   restriction of developmental potential during asymmetric stem cell
RT   division.";
RL   Dev. Cell 40:367-380(2017).
CC   -!- FUNCTION: ETS transcription factor with a prominent role during
CC       development of the eye and the nervous system (PubMed:8223245,
CC       PubMed:8033205, PubMed:23757412, PubMed:28245922). Required for glial-
CC       neuronal cell interactions at the ventral midline which are necessary
CC       for the proper elaboration of commissures in the embryonic CNS
CC       (PubMed:8223245). {ECO:0000269|PubMed:23757412,
CC       ECO:0000269|PubMed:28245922, ECO:0000269|PubMed:8033205,
CC       ECO:0000269|PubMed:8223245}.
CC   -!- FUNCTION: [Isoform P2]: Required for normal EGFR-induced photoreceptor
CC       development probably as a downstream effector of Ras85D
CC       (PubMed:8033205, PubMed:23757412). In larval eye imaginal disks,
CC       activated by MAPK phosphorylation following EGFR activation, induces
CC       transcription of isoform P1 which in turn activates transcription of
CC       target genes essential for photoreceptor development (PubMed:23757412).
CC   -!- FUNCTION: [Isoform P1]: Required for normal EGFR-induced photoreceptor
CC       development (PubMed:23757412). Following transcriptional activation by
CC       isoform P2, acts as a constitutive activator of transcription, leading
CC       to induction of target genes essential for photoreceptor development
CC       (PubMed:8033205, PubMed:23757412). In larval brains, involved in the
CC       maintenance of type II neuroblast self-renewal and identity together
CC       with brat, btd and pros; prevents intermediate neuronal progenitor
CC       (INP) dedifferentiation by regulating the expression of erm probably
CC       via Notch signaling; suppresses Ase expression in type II neuroblasts
CC       and promotes the generation of intermediate neuronal progenitors
CC       (PubMed:22143802, PubMed:27151950, PubMed:27510969, PubMed:28899667,
CC       PubMed:28245922). {ECO:0000269|PubMed:22143802,
CC       ECO:0000269|PubMed:23757412, ECO:0000269|PubMed:27151950,
CC       ECO:0000269|PubMed:27510969, ECO:0000269|PubMed:28245922,
CC       ECO:0000269|PubMed:28899667, ECO:0000269|PubMed:8033205}.
CC   -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:22143802}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=4;
CC       Name=P2 {ECO:0000303|PubMed:8223245}; Synonyms=B
CC       {ECO:0000312|FlyBase:FBgn0003118};
CC         IsoId=P51023-1; Sequence=Displayed;
CC       Name=D {ECO:0000312|FlyBase:FBgn0003118};
CC         IsoId=P51023-2; Sequence=VSP_059597;
CC       Name=P1 {ECO:0000303|PubMed:8223245}; Synonyms=C
CC       {ECO:0000312|FlyBase:FBgn0003118};
CC         IsoId=P51023-3, P51022-1;
CC         Sequence=VSP_059596;
CC       Name=E {ECO:0000312|FlyBase:FBgn0003118};
CC         IsoId=P51023-4; Sequence=VSP_059595;
CC   -!- DEVELOPMENTAL STAGE: Expressed in type II neuroblasts in larval brain
CC       (at protein level) (PubMed:27151950, PubMed:28245922). Expressed in a
CC       complex dynamic pattern in early embryos, including the midline and
CC       midline glial cells (PubMed:8223245, PubMed:1577186, PubMed:2834248).
CC       Expressed throughout development with lower levels during larval
CC       development (PubMed:1577186). Expressed in the eye imaginal disk in and
CC       posterior to the morphogenetic furrow (PubMed:8033205). Isoform P2:
CC       Detected in the precellular blastoderm stage localized at the anterior
CC       tip of the embryo (PubMed:8223245). Detected during gastrulation in the
CC       mesoderm (PubMed:8223245, PubMed:23757412). As the germband retracts
CC       (stage 12) detected in a few cells located at the dorsal roof at the
CC       midline of the CNS (PubMed:8223245). These cells correspond to the
CC       midline glial cells, in which expression continues until the end of
CC       embryogenesis (PubMed:8223245). Major isoform expressed in the eye
CC       imaginal disk in and posterior to the morphogenetic furrow
CC       (PubMed:8033205). Isoform P1: Expressed within the differentiated
CC       region of the disk including and posterior to the morphogenetic furrow
CC       in the proneural photoreptor clusters (at protein level)
CC       (PubMed:23757412). Detected during the cellular blastoderm stage in two
CC       broad stripes in the lateral neurogenic region (PubMed:8223245). At the
CC       beginning of gastrulation detected in the dorsal edge of the neurogenic
CC       region (PubMed:8223245). During segmentation (stage 11), detected in
CC       the ventral ectoderm and in a group of cells surrounding the future
CC       tracheal pits, in the head region and the lateral body wall
CC       (PubMed:8223245). In the CNS, detected during germband retraction, in
CC       the glial cells and in the midline (PubMed:8223245). In larval brains,
CC       major neuroblast-specific isoform (PubMed:22143802).
CC       {ECO:0000269|PubMed:1577186, ECO:0000269|PubMed:22143802,
CC       ECO:0000269|PubMed:23757412, ECO:0000269|PubMed:27151950,
CC       ECO:0000269|PubMed:28245922, ECO:0000269|PubMed:2834248,
CC       ECO:0000269|PubMed:8033205, ECO:0000269|PubMed:8223245}.
CC   -!- PTM: [Isoform P2]: Phosphorylated at Thr-151 by rl.
CC       {ECO:0000269|PubMed:8033205}.
CC   -!- DISRUPTION PHENOTYPE: Embryonic lethal showing loss of photoreceptors
CC       (PubMed:8033205, PubMed:8223245, PubMed:23757412). In larvae, RNAi-
CC       mediated knockdown results in a transformation of type II neuroblasts
CC       into type I neuroblasts, elimination of intermediary neuronal
CC       progenitors (INP) and generation of extra type II neuroblasts; in the
CC       ventral nerve cord, results in increased numbers of type I neuroblasts
CC       (PubMed:27510969, PubMed:28899667, PubMed:27151950). Simultaneous RNAi-
CC       mediated knockdown of the zinc-finger transcriptional repressor erm,
CC       the transcriptional repressor E(spl)mdelta-HLH or the transcriptional
CC       repressor dpn restore normal neuroblast numbers (PubMed:28899667).
CC       Simultaneous RNAi-mediated knockdown of N partially restores normal
CC       neuroblast numbers and inhibits ectopic erm expression in the central
CC       brain and ventral nerve cord (PubMed:27151950).
CC       {ECO:0000269|PubMed:23757412, ECO:0000269|PubMed:27151950,
CC       ECO:0000269|PubMed:27510969, ECO:0000269|PubMed:28899667,
CC       ECO:0000269|PubMed:8033205, ECO:0000269|PubMed:8223245}.
CC   -!- SIMILARITY: Belongs to the ETS family. {ECO:0000305}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=AAN71682.1; Type=Miscellaneous discrepancy; Note=Aberrant splicing.; Evidence={ECO:0000305};
DR   EMBL; X69166; CAA48916.1; -; mRNA.
DR   EMBL; X69167; CAA48917.1; -; mRNA.
DR   EMBL; M88472; AAC34200.1; -; mRNA.
DR   EMBL; M20408; AAA28521.1; -; Genomic_DNA.
DR   EMBL; AE014297; AAF56125.1; -; Genomic_DNA.
DR   EMBL; AE014297; AAN13942.1; -; Genomic_DNA.
DR   EMBL; AE014297; AAN13943.1; -; Genomic_DNA.
DR   EMBL; AE014297; AGB96252.1; -; Genomic_DNA.
DR   EMBL; BT001893; AAN71682.1; ALT_SEQ; mRNA.
DR   EMBL; BT024187; ABC86249.1; -; mRNA.
DR   EMBL; BT058033; ACM16754.1; -; mRNA.
DR   EMBL; BT133301; AFD10748.1; -; mRNA.
DR   PIR; S33167; S33167.
DR   PIR; S33168; S33168.
DR   RefSeq; NP_001262872.1; NM_001275943.1. [P51023-4]
DR   RefSeq; NP_524461.2; NM_079737.3. [P51023-1]
DR   RefSeq; NP_732857.1; NM_170651.4. [P51023-2]
DR   RefSeq; NP_732858.1; NM_170070.2. [P51023-3]
DR   SMR; P51023; -.
DR   BioGRID; 67700; 41.
DR   DIP; DIP-19576N; -.
DR   IntAct; P51023; 10.
DR   MINT; P51023; -.
DR   STRING; 7227.FBpp0088658; -.
DR   iPTMnet; P51023; -.
DR   PaxDb; P51023; -.
DR   EnsemblMetazoa; FBtr0089715; FBpp0088656; FBgn0003118. [P51023-3]
DR   EnsemblMetazoa; FBtr0089716; FBpp0088657; FBgn0003118. [P51023-2]
DR   EnsemblMetazoa; FBtr0089717; FBpp0088658; FBgn0003118. [P51023-1]
DR   EnsemblMetazoa; FBtr0334554; FBpp0306621; FBgn0003118. [P51023-4]
DR   GeneID; 42757; -.
DR   KEGG; dme:Dmel_CG17077; -.
DR   UCSC; CG17077-RD; d. melanogaster.
DR   CTD; 42757; -.
DR   FlyBase; FBgn0003118; pnt.
DR   eggNOG; KOG3806; Eukaryota.
DR   GeneTree; ENSGT00940000166428; -.
DR   HOGENOM; CLU_021277_0_0_1; -.
DR   InParanoid; P51023; -.
DR   KO; K02678; -.
DR   OMA; GNAYYTD; -.
DR   PhylomeDB; P51023; -.
DR   Reactome; R-DME-2559585; Oncogene Induced Senescence.
DR   SignaLink; P51023; -.
DR   BioGRID-ORCS; 42757; 3 hits in 5 CRISPR screens.
DR   ChiTaRS; pnt; fly.
DR   GenomeRNAi; 42757; -.
DR   PRO; PR:P51023; -.
DR   Proteomes; UP000000803; Chromosome 3R.
DR   Bgee; FBgn0003118; Expressed in embryo and 87 other tissues.
DR   ExpressionAtlas; P51023; baseline and differential.
DR   Genevisible; P51023; DM.
DR   GO; GO:0042025; C:host cell nucleus; IEA:InterPro.
DR   GO; GO:0005634; C:nucleus; IDA:FlyBase.
DR   GO; GO:0001228; F:DNA-binding transcription activator activity, RNA polymerase II-specific; IDA:FlyBase.
DR   GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; IBA:GO_Central.
DR   GO; GO:0043565; F:sequence-specific DNA binding; IDA:UniProtKB.
DR   GO; GO:0000976; F:transcription regulatory region sequence-specific DNA binding; IDA:UniProtKB.
DR   GO; GO:0043697; P:cell dedifferentiation; IMP:UniProtKB.
DR   GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
DR   GO; GO:0001751; P:compound eye photoreceptor cell differentiation; IMP:FlyBase.
DR   GO; GO:0008340; P:determination of adult lifespan; IGI:FlyBase.
DR   GO; GO:0035225; P:determination of genital disc primordium; IMP:FlyBase.
DR   GO; GO:0007173; P:epidermal growth factor receptor signaling pathway; IMP:FlyBase.
DR   GO; GO:0007427; P:epithelial cell migration, open tracheal system; IMP:FlyBase.
DR   GO; GO:0061331; P:epithelial cell proliferation involved in Malpighian tubule morphogenesis; IMP:FlyBase.
DR   GO; GO:0007455; P:eye-antennal disc morphogenesis; IMP:FlyBase.
DR   GO; GO:0008543; P:fibroblast growth factor receptor signaling pathway; IMP:FlyBase.
DR   GO; GO:0007476; P:imaginal disc-derived wing morphogenesis; IMP:FlyBase.
DR   GO; GO:0007479; P:leg disc proximal/distal pattern formation; IEP:FlyBase.
DR   GO; GO:0035170; P:lymph gland crystal cell differentiation; IMP:FlyBase.
DR   GO; GO:0035169; P:lymph gland plasmatocyte differentiation; IMP:FlyBase.
DR   GO; GO:0048747; P:muscle fiber development; IMP:FlyBase.
DR   GO; GO:2001234; P:negative regulation of apoptotic signaling pathway; IGI:FlyBase.
DR   GO; GO:0009997; P:negative regulation of cardioblast cell fate specification; IMP:FlyBase.
DR   GO; GO:0043433; P:negative regulation of DNA-binding transcription factor activity; IDA:FlyBase.
DR   GO; GO:0001742; P:oenocyte differentiation; IMP:FlyBase.
DR   GO; GO:0016318; P:ommatidial rotation; IMP:FlyBase.
DR   GO; GO:0007424; P:open tracheal system development; IMP:FlyBase.
DR   GO; GO:0061320; P:pericardial nephrocyte differentiation; IMP:FlyBase.
DR   GO; GO:0042461; P:photoreceptor cell development; IMP:UniProtKB.
DR   GO; GO:0008284; P:positive regulation of cell population proliferation; IMP:FlyBase.
DR   GO; GO:0010628; P:positive regulation of gene expression; IDA:FlyBase.
DR   GO; GO:0045666; P:positive regulation of neuron differentiation; IMP:UniProtKB.
DR   GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:FlyBase.
DR   GO; GO:0045893; P:positive regulation of transcription, DNA-templated; IMP:UniProtKB.
DR   GO; GO:0007428; P:primary branching, open tracheal system; IMP:FlyBase.
DR   GO; GO:0007464; P:R3/R4 cell fate commitment; IMP:FlyBase.
DR   GO; GO:0007465; P:R7 cell fate commitment; IMP:FlyBase.
DR   GO; GO:0090175; P:regulation of establishment of planar polarity; IMP:FlyBase.
DR   GO; GO:1902692; P:regulation of neuroblast proliferation; IMP:UniProtKB.
DR   GO; GO:0050767; P:regulation of neurogenesis; IMP:FlyBase.
DR   GO; GO:0045664; P:regulation of neuron differentiation; IGI:UniProtKB.
DR   GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IBA:GO_Central.
DR   GO; GO:0007429; P:secondary branching, open tracheal system; IMP:FlyBase.
DR   GO; GO:0045500; P:sevenless signaling pathway; IDA:FlyBase.
DR   GO; GO:0035154; P:terminal cell fate specification, open tracheal system; HMP:FlyBase.
DR   GO; GO:0060438; P:trachea development; IMP:FlyBase.
DR   GO; GO:0048190; P:wing disc dorsal/ventral pattern formation; IGI:FlyBase.
DR   DisProt; DP01749; -.
DR   Gene3D; 1.10.10.10; -; 1.
DR   Gene3D; 1.10.150.50; -; 1.
DR   InterPro; IPR000418; Ets_dom.
DR   InterPro; IPR003118; Pointed_dom.
DR   InterPro; IPR013761; SAM/pointed_sf.
DR   InterPro; IPR036388; WH-like_DNA-bd_sf.
DR   InterPro; IPR036390; WH_DNA-bd_sf.
DR   Pfam; PF00178; Ets; 1.
DR   Pfam; PF02198; SAM_PNT; 1.
DR   PRINTS; PR00454; ETSDOMAIN.
DR   SMART; SM00413; ETS; 1.
DR   SMART; SM00251; SAM_PNT; 1.
DR   SUPFAM; SSF46785; SSF46785; 1.
DR   SUPFAM; SSF47769; SSF47769; 1.
DR   PROSITE; PS00345; ETS_DOMAIN_1; 1.
DR   PROSITE; PS00346; ETS_DOMAIN_2; 1.
DR   PROSITE; PS50061; ETS_DOMAIN_3; 1.
DR   PROSITE; PS51433; PNT; 1.
PE   1: Evidence at protein level;
KW   Activator; Alternative splicing; Developmental protein; DNA-binding;
KW   Nucleus; Phosphoprotein; Reference proteome; Transcription;
KW   Transcription regulation.
FT   CHAIN           1..718
FT                   /note="ETS-like protein pointed"
FT                   /id="PRO_0000204130"
FT   DOMAIN          164..250
FT                   /note="PNT"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00762"
FT   DNA_BIND        610..690
FT                   /note="ETS"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00237,
FT                   ECO:0000269|PubMed:1577186, ECO:0000269|PubMed:28245922,
FT                   ECO:0000269|PubMed:8223245"
FT   COMPBIAS        280..415
FT                   /note="Asn-rich"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00003"
FT   COMPBIAS        432..522
FT                   /note="Gly-rich"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00008"
FT   MOD_RES         151
FT                   /note="Phosphothreonine"
FT                   /evidence="ECO:0000269|PubMed:8033205"
FT   VAR_SEQ         1..323
FT                   /note="MELAICKTDLSATKFMLPPALPSSAAIGSSSAVASTASHFLDKAAHELFQLN
FT                   AINGHLFKSPASSHLNSVGSPSILSQLNGIGNSGNHSGQVSTMRLKKNRKVTFLSSLVE
FT                   SKNIFIKEEPIHGCKDLCSLSDISDHEASLEVPTALPPLTPGTNRKVNEVLKASFASWE
FT                   KEVQKCNITKDPREWTEEHVIYWLNWAKNEFSLVSMNLDPFYKMKGRAMVDLGKEKFLA
FT                   ITPPFTGDILWEHLDILQKDCEKPNEDIVHGNSFESATTASVCGSDHQVANYPNETHAN
FT                   SNNSSINSRLSMDYVTSAGNSDNKNFHRATPHSHN -> MPPSAFLVNASIISAANALD
FT                   SDKEQQLQEHLNQSHFTSSSSSSNSSNNNNCHTAPNYNMVLQSYENYPSYHLAQHHHHH
FT                   HHHHSHPHHQLAQQTGLHSHHTMQQQLQQQQQSLLLQHPQQQQQQHSHQSQQQQQHGYG
FT                   SSAQLPHHRLSGGSTGSTTTTSSGSSSSGSSSSASSQGFANGSATANNLVGALSSSTAA
FT                   SLGLGYFNDMAPFVGDANAYYTDSDVNFFSSGT (in isoform E)"
FT                   /evidence="ECO:0000305"
FT                   /id="VSP_059595"
FT   VAR_SEQ         1..323
FT                   /note="MELAICKTDLSATKFMLPPALPSSAAIGSSSAVASTASHFLDKAAHELFQLN
FT                   AINGHLFKSPASSHLNSVGSPSILSQLNGIGNSGNHSGQVSTMRLKKNRKVTFLSSLVE
FT                   SKNIFIKEEPIHGCKDLCSLSDISDHEASLEVPTALPPLTPGTNRKVNEVLKASFASWE
FT                   KEVQKCNITKDPREWTEEHVIYWLNWAKNEFSLVSMNLDPFYKMKGRAMVDLGKEKFLA
FT                   ITPPFTGDILWEHLDILQKDCEKPNEDIVHGNSFESATTASVCGSDHQVANYPNETHAN
FT                   SNNSSINSRLSMDYVTSAGNSDNKNFHRATPHSHN -> MPPSAFLVNASIISAANALD
FT                   SDKEQQLQEHLNQSHFTSSSSSSNSSNNNNCHTAPNYNMVLQSYENYPSYHLAQHHHHH
FT                   HHHHSHPHHQLAQQTGLHSHHTMQQQLQQQQQSLLLQHPQQQQQQHSHQSQQQQQHGYG
FT                   SSAQLPHHRLSGGSTGSTTTTSSGSSSSGSSSSASSQGFANGSATANNLVGALSSSTAA
FT                   SLGLGYFNDMAPFVGDANAYYTDSDVNFFSS (in isoform P1)"
FT                   /evidence="ECO:0000305"
FT                   /id="VSP_059596"
FT   VAR_SEQ         1..141
FT                   /note="MELAICKTDLSATKFMLPPALPSSAAIGSSSAVASTASHFLDKAAHELFQLN
FT                   AINGHLFKSPASSHLNSVGSPSILSQLNGIGNSGNHSGQVSTMRLKKNRKVTFLSSLVE
FT                   SKNIFIKEEPIHGCKDLCSLSDISDHEASL -> MTNEWIDWNDSRMLPPLRSANYNYH
FT                   PQTFLPNNYQCFTGKFHLKGQKLQQLTTNHSKLK (in isoform D)"
FT                   /evidence="ECO:0000305"
FT                   /id="VSP_059597"
FT   MUTAGEN         151
FT                   /note="T->A: Reduced activity and lack of response to
FT                   Ras85D or rl stimulation."
FT                   /evidence="ECO:0000269|PubMed:8033205"
FT   CONFLICT        133..135
FT                   /note="DIS -> VYP (in Ref. 1; CAA48917)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        420
FT                   /note="A -> AM (in Ref. 1; CAA48917)"
FT                   /evidence="ECO:0000305"
SQ   SEQUENCE   718 AA;  77683 MW;  FD6AFD0F4BCD69C5 CRC64;
     MELAICKTDL SATKFMLPPA LPSSAAIGSS SAVASTASHF LDKAAHELFQ LNAINGHLFK
     SPASSHLNSV GSPSILSQLN GIGNSGNHSG QVSTMRLKKN RKVTFLSSLV ESKNIFIKEE
     PIHGCKDLCS LSDISDHEAS LEVPTALPPL TPGTNRKVNE VLKASFASWE KEVQKCNITK
     DPREWTEEHV IYWLNWAKNE FSLVSMNLDP FYKMKGRAMV DLGKEKFLAI TPPFTGDILW
     EHLDILQKDC EKPNEDIVHG NSFESATTAS VCGSDHQVAN YPNETHANSN NSSINSRLSM
     DYVTSAGNSD NKNFHRATPH SHNGYNTSNT HDRINNSTPP QQQQSQQPTV NGSGSASSNN
     NNSMLPPAVQ QSNNENNNTS SSNTNNSSNN NNNSGGSNNS NAGSNNNNNN NNNINFMAAA
     AIFQHHLKEE PGTQNGNIGG YGGGSNSQND PTDLSSYGLP AHLAAYGGGS GSGPTGGRSS
     GGGGDESDYH STISAQDHQS QQSSGGNGSG GASGGSTGNS NGYLDSSSEF YGSYAGRNRF
     HDGYPPEFTP YDAQSFQSMG PQPTAMDQWG AAHAHQHPAA YMSTLGLDKG LLGGYTTQGG
     VPCFTGSGPI QLWQFLLELL LDKTCQSFIS WTGDGWEFKL TDPDEVARRW GIRKNKPKMN
     YEKLSRGLRY YYDKNIIHKT AGKRYVYRFV CDLQNLVGHT PEELVAKYDL KIEKKDVD
//
DBGET integrated database retrieval system