GenomeNet

Database: UniProt
Entry: Q6NVV9
LinkDB: Q6NVV9
Original site: Q6NVV9 
  All links  
No link information was found.   
ID   ADAM5_HUMAN             Reviewed;         412 AA.
AC   Q6NVV9; A8MW71; Q4G196;
DT   02-SEP-2008, integrated into UniProtKB/Swiss-Prot.
DT   30-AUG-2005, sequence version 2.
DT   16-JAN-2019, entry version 107.
DE   RecName: Full=Putative disintegrin and metalloproteinase domain-containing protein 5;
DE   AltName: Full=Putative transmembrane metalloproteinase-like, disintegrin-like, and cysteine-rich protein II;
DE            Short=tMDC II;
GN   Name=ADAM5; Synonyms=ADAM5P, TMDC2;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6 AND 7), FUNCTION,
RP   TISSUE SPECIFICITY, AND ALTERNATIVE SPLICING.
RX   PubMed=10417343; DOI=10.1042/bj3410771;
RA   Frayne J., Dimsey E.A., Jury J.A., Hall L.;
RT   "Transcripts encoding the sperm surface protein tMDC II are non-
RT   functional in the human.";
RL   Biochem. J. 341:771-775(1999).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=16421571; DOI=10.1038/nature04406;
RA   Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S.,
RA   Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A.,
RA   Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X.,
RA   Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T.,
RA   Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K.,
RA   DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G.,
RA   Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B.,
RA   Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P.,
RA   Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H.,
RA   Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C.,
RA   O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K.,
RA   Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R.,
RA   Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K.,
RA   Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q.,
RA   Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N.,
RA   Lander E.S.;
RT   "DNA sequence and analysis of human chromosome 8.";
RL   Nature 439:331-335(2006).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
RC   TISSUE=Testis;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
CC   -!- FUNCTION: This is a non catalytic metalloprotease-like protein.
CC       {ECO:0000250, ECO:0000269|PubMed:10417343}.
CC   -!- SUBUNIT: Interacts with TEX101. {ECO:0000250|UniProtKB:Q3TTE0}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=7;
CC       Name=1;
CC         IsoId=Q6NVV9-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q6NVV9-2; Sequence=VSP_035340, VSP_035343, VSP_035344;
CC       Name=3;
CC         IsoId=Q6NVV9-3; Sequence=VSP_035339, VSP_035341;
CC       Name=4;
CC         IsoId=Q6NVV9-4; Sequence=VSP_035340;
CC       Name=5;
CC         IsoId=Q6NVV9-5; Sequence=VSP_035340, VSP_035342;
CC       Name=6;
CC         IsoId=Q6NVV9-6; Sequence=VSP_035345;
CC       Name=7;
CC         IsoId=Q6NVV9-7; Sequence=VSP_035346;
CC   -!- TISSUE SPECIFICITY: Highly expressed in testis.
CC       {ECO:0000269|PubMed:10417343}.
CC   -!- CAUTION: Could be the product of a pseudogene. Not expected to
CC       have protease activity. {ECO:0000305}.
DR   EMBL; AJ132820; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AJ132821; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AJ132822; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AJ132823; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AJ132824; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AJ132825; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AJ132826; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AJ132827; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AC105185; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BC026083; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; BC067864; -; NOT_ANNOTATED_CDS; mRNA.
DR   UniGene; Hs.369765; -.
DR   ProteinModelPortal; Q6NVV9; -.
DR   SMR; Q6NVV9; -.
DR   BioMuta; HGNC:212; -.
DR   DMDM; 121946258; -.
DR   jPOST; Q6NVV9; -.
DR   PRIDE; Q6NVV9; -.
DR   ProteomicsDB; 66726; -.
DR   ProteomicsDB; 66727; -. [Q6NVV9-2]
DR   ProteomicsDB; 66728; -. [Q6NVV9-3]
DR   ProteomicsDB; 66729; -. [Q6NVV9-4]
DR   ProteomicsDB; 66730; -. [Q6NVV9-5]
DR   ProteomicsDB; 66731; -. [Q6NVV9-6]
DR   ProteomicsDB; 66732; -. [Q6NVV9-7]
DR   TopDownProteomics; Q6NVV9-7; -. [Q6NVV9-7]
DR   GeneCards; ADAM5; -.
DR   HGNC; HGNC:212; ADAM5.
DR   neXtProt; NX_Q6NVV9; -.
DR   InParanoid; Q6NVV9; -.
DR   PhylomeDB; Q6NVV9; -.
DR   Proteomes; UP000005640; Unplaced.
DR   Gene3D; 4.10.70.10; -; 1.
DR   InterPro; IPR006586; ADAM_Cys-rich.
DR   InterPro; IPR001762; Disintegrin_dom.
DR   InterPro; IPR036436; Disintegrin_dom_sf.
DR   InterPro; IPR013032; EGF-like_CS.
DR   InterPro; IPR000742; EGF-like_dom.
DR   InterPro; IPR002870; Peptidase_M12B_N.
DR   Pfam; PF08516; ADAM_CR; 1.
DR   Pfam; PF01562; Pep_M12B_propep; 1.
DR   SMART; SM00608; ACR; 1.
DR   SMART; SM00050; DISIN; 1.
DR   SUPFAM; SSF57552; SSF57552; 1.
DR   PROSITE; PS01186; EGF_2; 1.
DR   PROSITE; PS50026; EGF_3; 1.
PE   5: Uncertain;
KW   Alternative splicing; Complete proteome; EGF-like domain;
KW   Reference proteome.
FT   CHAIN         1    412       Putative disintegrin and
FT                                metalloproteinase domain-containing
FT                                protein 5.
FT                                /FTId=PRO_0000349304.
FT   DOMAIN      111    199       Disintegrin.
FT   DOMAIN      351    385       EGF-like. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00076}.
FT   VAR_SEQ       1     84       Missing (in isoform 3).
FT                                {ECO:0000303|PubMed:10417343}.
FT                                /FTId=VSP_035339.
FT   VAR_SEQ       1     57       Missing (in isoform 2, isoform 4 and
FT                                isoform 5). {ECO:0000303|PubMed:10417343,
FT                                ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_035340.
FT   VAR_SEQ      85    162       TMQLKNISYGIEPMEAVSGFIHKIYEEKYADTNILLEENDT
FT                                YTWFNSEYQVRKSSEKTDFIKLFPRYIEMHIVVDKNL ->
FT                                MTLILGLIQSIKSEKVQKYSGGVKDFNICSLDDFKYISSHN
FT                                GLTCLQTNPLEMPHRRICGNGLLEGSEECDCGTKD (in
FT                                isoform 3).
FT                                {ECO:0000303|PubMed:10417343}.
FT                                /FTId=VSP_035341.
FT   VAR_SEQ     141    162       Missing (in isoform 5).
FT                                {ECO:0000303|PubMed:10417343}.
FT                                /FTId=VSP_035342.
FT   VAR_SEQ     163    170       FKPANMIC -> VLWWCKGF (in isoform 2).
FT                                {ECO:0000303|PubMed:10417343,
FT                                ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_035343.
FT   VAR_SEQ     171    412       Missing (in isoform 2).
FT                                {ECO:0000303|PubMed:10417343,
FT                                ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_035344.
FT   VAR_SEQ     337    365       Missing (in isoform 6).
FT                                {ECO:0000303|PubMed:10417343}.
FT                                /FTId=VSP_035345.
FT   VAR_SEQ     404    412       ERSYMEEGR -> APVS (in isoform 7).
FT                                {ECO:0000303|PubMed:10417343}.
FT                                /FTId=VSP_035346.
SQ   SEQUENCE   412 AA;  47181 MW;  8F1E8FC241CFD471 CRC64;
     MQTSILIKSS CRPQFQRRFH HRMQKQIQNI ISILSSASVI NSYDENDIRH SKPLLVQMDC
     NYNGYVAGIP NSLVTLSVCS GLRGTMQLKN ISYGIEPMEA VSGFIHKIYE EKYADTNILL
     EENDTYTWFN SEYQVRKSSE KTDFIKLFPR YIEMHIVVDK NLFKPANMIC RKSVGKECDF
     TEYCNGDLPY CLPDTYVRDG EYCDSGGAFC FQGKCRTFDK QCDDLIGRGS RGAPVFCYDE
     INTRGDNFGN CGTAHCLFQH ILCGKLVCTW EHRDLISRPN LSVIYAHVRD QTCVSTYLPR
     RTPPPVNSPI SITSYYSAED RDETFVQDGS MCGPDMYCFE MHCKHVRFLM NLKLCDASNH
     CDRHGVCNNF NHCHCEKGYN PPYCQPKQGA FGSIDDGHLV PPTERSYMEE GR
//
DBGET integrated database retrieval system