GenomeNet

Database: UniProt
Entry: Q7Z407
LinkDB: Q7Z407
Original site: Q7Z407 
ID   CSMD3_HUMAN             Reviewed;        3707 AA.
AC   Q7Z407; Q96PZ3;
DT   28-NOV-2003, integrated into UniProtKB/Swiss-Prot.
DT   01-SEP-2009, sequence version 3.
DT   07-NOV-2018, entry version 129.
DE   RecName: Full=CUB and sushi domain-containing protein 3;
DE   AltName: Full=CUB and sushi multiple domains protein 3;
GN   Name=CSMD3; Synonyms=KIAA1894;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
RX   PubMed=12906867; DOI=10.1016/S0888-7543(03)00149-6;
RA   Lau W.L., Scholnick S.B.;
RT   "Identification of two new members of the CSMD gene family.";
RL   Genomics 82:412-415(2003).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, AND
RP   VARIANTS MET-219 AND HIS-3621.
RC   TISSUE=Brain, and Testis;
RX   PubMed=12943675; DOI=10.1016/S0006-291X(03)01555-9;
RA   Shimizu A., Asakawa S., Shimizu N.;
RT   "A novel giant gene CSMD3 encoding a protein with CUB and sushi
RT   multiple domains: a candidate gene for benign adult familial myoclonic
RT   epilepsy on human chromosome 8q23.3-q24.1.";
RL   Biochem. Biophys. Res. Commun. 309:143-154(2003).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 661-3707 (ISOFORM 4), AND
RP   TISSUE SPECIFICITY.
RC   TISSUE=Brain;
RX   PubMed=11572484; DOI=10.1093/dnares/8.4.179;
RA   Nagase T., Kikuno R., Ohara O.;
RT   "Prediction of the coding sequences of unidentified human genes. XXI.
RT   The complete sequences of 60 new cDNA clones from brain which code for
RT   large proteins.";
RL   DNA Res. 8:179-187(2001).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2271-3707 (ISOFORM 5).
RC   TISSUE=Liver;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [5]
RP   VARIANTS [LARGE SCALE ANALYSIS] GLY-322; HIS-3079 AND GLN-3359.
RX   PubMed=16959974; DOI=10.1126/science.1133427;
RA   Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
RA   Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
RA   Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
RA   Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
RA   Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
RA   Vogelstein B., Kinzler K.W., Velculescu V.E.;
RT   "The consensus coding sequences of human breast and colorectal
RT   cancers.";
RL   Science 314:268-274(2006).
RN   [6]
RP   VARIANT CYS-2020.
RX   PubMed=21248752; DOI=10.1038/nature09639;
RA   Varela I., Tarpey P., Raine K., Huang D., Ong C.K., Stephens P.,
RA   Davies H., Jones D., Lin M.L., Teague J., Bignell G., Butler A.,
RA   Cho J., Dalgliesh G.L., Galappaththige D., Greenman C., Hardy C.,
RA   Jia M., Latimer C., Lau K.W., Marshall J., McLaren S., Menzies A.,
RA   Mudie L., Stebbings L., Largaespada D.A., Wessels L.F.A., Richard S.,
RA   Kahnoski R.J., Anema J., Tuveson D.A., Perez-Mancera P.A.,
RA   Mustonen V., Fischer A., Adams D.J., Rust A., Chan-On W., Subimerb C.,
RA   Dykema K., Furge K., Campbell P.J., Teh B.T., Stratton M.R.,
RA   Futreal P.A.;
RT   "Exome sequencing identifies frequent mutation of the SWI/SNF complex
RT   gene PBRM1 in renal carcinoma.";
RL   Nature 469:539-542(2011).
CC   -!- FUNCTION: Involved in dendrite development.
CC       {ECO:0000250|UniProtKB:Q80T79}.
CC   -!- SUBCELLULAR LOCATION: Cell membrane
CC       {ECO:0000250|UniProtKB:Q80T79}; Multi-pass membrane protein
CC       {ECO:0000250|UniProtKB:Q80T79}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=5;
CC       Name=1;
CC         IsoId=Q7Z407-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q7Z407-2; Sequence=VSP_009047;
CC       Name=3;
CC         IsoId=Q7Z407-3; Sequence=VSP_009048, VSP_009049;
CC       Name=4;
CC         IsoId=Q7Z407-4; Sequence=VSP_009050;
CC         Note=No experimental confirmation available.;
CC       Name=5;
CC         IsoId=Q7Z407-5; Sequence=VSP_009051, VSP_009052;
CC         Note=No experimental confirmation available.;
CC   -!- TISSUE SPECIFICITY: Weakly expressed in most tissues, except in
CC       brain. Expressed at intermediate level in brain, including
CC       cerebellum, substantia nigra, thalamus, spinal cord, hippocampus
CC       and fetal brain. Also expressed in testis.
CC       {ECO:0000269|PubMed:11572484, ECO:0000269|PubMed:12943675}.
CC   -!- DOMAIN: The intracellular region is dispensable for its function.
CC       {ECO:0000250|UniProtKB:Q80T79}.
CC   -!- SIMILARITY: Belongs to the CSMD family. {ECO:0000305}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=AAO34702.1; Type=Erroneous initiation; Evidence={ECO:0000305};
DR   EMBL; AY210419; AAO34702.1; ALT_INIT; mRNA.
DR   EMBL; AB114604; BAC82443.1; -; mRNA.
DR   EMBL; AB114605; BAC82444.1; -; mRNA.
DR   EMBL; AB067481; BAB67787.2; -; mRNA.
DR   EMBL; AK126252; -; NOT_ANNOTATED_CDS; mRNA.
DR   CCDS; CCDS6315.1; -. [Q7Z407-1]
DR   CCDS; CCDS6316.2; -. [Q7Z407-3]
DR   CCDS; CCDS6317.1; -. [Q7Z407-2]
DR   RefSeq; NP_443132.3; NM_052900.2. [Q7Z407-3]
DR   RefSeq; NP_937756.1; NM_198123.1. [Q7Z407-1]
DR   RefSeq; NP_937757.1; NM_198124.1. [Q7Z407-2]
DR   RefSeq; XP_016868498.1; XM_017013009.1. [Q7Z407-4]
DR   UniGene; Hs.91381; -.
DR   ProteinModelPortal; Q7Z407; -.
DR   SMR; Q7Z407; -.
DR   BioGrid; 125350; 1.
DR   STRING; 9606.ENSP00000297405; -.
DR   iPTMnet; Q7Z407; -.
DR   PhosphoSitePlus; Q7Z407; -.
DR   BioMuta; CSMD3; -.
DR   DMDM; 257051058; -.
DR   MaxQB; Q7Z407; -.
DR   PaxDb; Q7Z407; -.
DR   PeptideAtlas; Q7Z407; -.
DR   PRIDE; Q7Z407; -.
DR   ProteomicsDB; 69118; -.
DR   ProteomicsDB; 69119; -. [Q7Z407-2]
DR   ProteomicsDB; 69120; -. [Q7Z407-3]
DR   ProteomicsDB; 69121; -. [Q7Z407-4]
DR   ProteomicsDB; 69122; -. [Q7Z407-5]
DR   Ensembl; ENST00000297405; ENSP00000297405; ENSG00000164796. [Q7Z407-1]
DR   Ensembl; ENST00000343508; ENSP00000345799; ENSG00000164796. [Q7Z407-2]
DR   Ensembl; ENST00000455883; ENSP00000412263; ENSG00000164796. [Q7Z407-3]
DR   GeneID; 114788; -.
DR   KEGG; hsa:114788; -.
DR   UCSC; uc003ynt.4; human. [Q7Z407-1]
DR   CTD; 114788; -.
DR   DisGeNET; 114788; -.
DR   EuPathDB; HostDB:ENSG00000164796.17; -.
DR   GeneCards; CSMD3; -.
DR   HGNC; HGNC:19291; CSMD3.
DR   HPA; HPA029007; -.
DR   MIM; 608399; gene.
DR   neXtProt; NX_Q7Z407; -.
DR   OpenTargets; ENSG00000164796; -.
DR   PharmGKB; PA134926063; -.
DR   eggNOG; KOG4297; Eukaryota.
DR   eggNOG; ENOG410XPJ1; LUCA.
DR   GeneTree; ENSGT00760000118803; -.
DR   HOGENOM; HOG000112015; -.
DR   HOVERGEN; HBG051134; -.
DR   InParanoid; Q7Z407; -.
DR   KO; K17495; -.
DR   OMA; SADHGTN; -.
DR   OrthoDB; EOG091G00EH; -.
DR   PhylomeDB; Q7Z407; -.
DR   TreeFam; TF316872; -.
DR   ChiTaRS; CSMD3; human.
DR   GenomeRNAi; 114788; -.
DR   PRO; PR:Q7Z407; -.
DR   Proteomes; UP000005640; Chromosome 8.
DR   Bgee; ENSG00000164796; Expressed in 83 organ(s), highest expression level in middle temporal gyrus.
DR   CleanEx; HS_CSMD3; -.
DR   ExpressionAtlas; Q7Z407; baseline and differential.
DR   Genevisible; Q7Z407; HS.
DR   GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR   GO; GO:0005886; C:plasma membrane; ISS:UniProtKB.
DR   GO; GO:0050773; P:regulation of dendrite development; ISS:UniProtKB.
DR   CDD; cd00033; CCP; 28.
DR   CDD; cd00041; CUB; 14.
DR   Gene3D; 2.60.120.290; -; 14.
DR   InterPro; IPR000859; CUB_dom.
DR   InterPro; IPR035914; Sperma_CUB_dom_sf.
DR   InterPro; IPR035976; Sushi/SCR/CCP_sf.
DR   InterPro; IPR000436; Sushi_SCR_CCP_dom.
DR   Pfam; PF00431; CUB; 14.
DR   Pfam; PF00084; Sushi; 28.
DR   SMART; SM00032; CCP; 28.
DR   SMART; SM00042; CUB; 14.
DR   SUPFAM; SSF49854; SSF49854; 14.
DR   SUPFAM; SSF57535; SSF57535; 28.
DR   PROSITE; PS01180; CUB; 14.
DR   PROSITE; PS50923; SUSHI; 28.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Cell membrane; Complete proteome;
KW   Disulfide bond; Glycoprotein; Membrane; Polymorphism;
KW   Reference proteome; Repeat; Sushi; Transmembrane; Transmembrane helix.
FT   CHAIN         1   3707       CUB and sushi domain-containing protein
FT                                3.
FT                                /FTId=PRO_0000021027.
FT   TOPO_DOM      1     42       Cytoplasmic. {ECO:0000255}.
FT   TRANSMEM     43     63       Helical. {ECO:0000255}.
FT   TOPO_DOM     64   3630       Extracellular. {ECO:0000255}.
FT   TRANSMEM   3631   3651       Helical. {ECO:0000255}.
FT   TOPO_DOM   3652   3707       Cytoplasmic. {ECO:0000255}.
FT   DOMAIN       65    173       CUB 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN      176    237       Sushi 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN      241    345       CUB 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN      484    545       Sushi 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN      548    659       CUB 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN      662    719       Sushi 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN      721    829       CUB 4. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN      832    893       Sushi 4. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN      895   1003       CUB 5. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     1008   1065       Sushi 5. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     1067   1177       CUB 6. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     1180   1239       Sushi 6. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     1241   1349       CUB 7. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     1352   1412       Sushi 7. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     1414   1523       CUB 8. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     1526   1586       Sushi 8. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     1588   1696       CUB 9. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     1699   1760       Sushi 9. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     1762   1870       CUB 10. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     1876   1937       Sushi 10. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     1939   2047       CUB 11. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     2050   2109       Sushi 11. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2111   2219       CUB 12. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     2222   2281       Sushi 12. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2283   2394       CUB 13. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     2393   2454       Sushi 13. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2456   2567       CUB 14. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00059}.
FT   DOMAIN     2567   2629       Sushi 14. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2630   2691       Sushi 15. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2692   2756       Sushi 16. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2757   2814       Sushi 17. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2815   2872       Sushi 18. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2873   2930       Sushi 19. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2931   2992       Sushi 20. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     2993   3050       Sushi 21. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     3054   3111       Sushi 22. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     3112   3170       Sushi 23. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     3171   3230       Sushi 24. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     3231   3288       Sushi 25. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     3289   3346       Sushi 26. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     3350   3408       Sushi 27. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   DOMAIN     3409   3468       Sushi 28. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00302}.
FT   CARBOHYD     73     73       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD     90     90       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    361    361       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    409    409       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    724    724       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    823    823       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    966    966       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1092   1092       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1126   1126       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1171   1171       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1280   1280       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1536   1536       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1591   1591       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1709   1709       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1781   1781       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1929   1929       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2019   2019       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2155   2155       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2286   2286       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2291   2291       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2324   2324       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2495   2495       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2537   2537       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2711   2711       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2742   2742       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2862   2862       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2932   2932       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   2952   2952       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3099   3099       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3158   3158       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3167   3167       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3194   3194       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3208   3208       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3218   3218       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3276   3276       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3364   3364       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3522   3522       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3529   3529       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3612   3612       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3618   3618       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   3627   3627       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   DISULFID     65     91       {ECO:0000250}.
FT   DISULFID    178    218       {ECO:0000250}.
FT   DISULFID    204    235       {ECO:0000250}.
FT   DISULFID    241    267       {ECO:0000250}.
FT   DISULFID    486    526       {ECO:0000250}.
FT   DISULFID    512    543       {ECO:0000250}.
FT   DISULFID    548    574       {ECO:0000250}.
FT   DISULFID    664    704       {ECO:0000250}.
FT   DISULFID    690    717       {ECO:0000250}.
FT   DISULFID    721    747       {ECO:0000250}.
FT   DISULFID    834    875       {ECO:0000250}.
FT   DISULFID    860    891       {ECO:0000250}.
FT   DISULFID    895    921       {ECO:0000250}.
FT   DISULFID   1010   1050       {ECO:0000250}.
FT   DISULFID   1036   1063       {ECO:0000250}.
FT   DISULFID   1067   1093       {ECO:0000250}.
FT   DISULFID   1182   1222       {ECO:0000250}.
FT   DISULFID   1208   1237       {ECO:0000250}.
FT   DISULFID   1241   1267       {ECO:0000250}.
FT   DISULFID   1354   1395       {ECO:0000250}.
FT   DISULFID   1381   1410       {ECO:0000250}.
FT   DISULFID   1414   1441       {ECO:0000250}.
FT   DISULFID   1528   1568       {ECO:0000250}.
FT   DISULFID   1554   1584       {ECO:0000250}.
FT   DISULFID   1588   1614       {ECO:0000250}.
FT   DISULFID   1701   1741       {ECO:0000250}.
FT   DISULFID   1727   1758       {ECO:0000250}.
FT   DISULFID   1762   1788       {ECO:0000250}.
FT   DISULFID   1878   1918       {ECO:0000250}.
FT   DISULFID   1904   1935       {ECO:0000250}.
FT   DISULFID   1939   1965       {ECO:0000250}.
FT   DISULFID   2052   2092       {ECO:0000250}.
FT   DISULFID   2078   2107       {ECO:0000250}.
FT   DISULFID   2111   2137       {ECO:0000250}.
FT   DISULFID   2224   2264       {ECO:0000250}.
FT   DISULFID   2250   2279       {ECO:0000250}.
FT   DISULFID   2283   2309       {ECO:0000250}.
FT   DISULFID   2395   2437       {ECO:0000250}.
FT   DISULFID   2423   2452       {ECO:0000250}.
FT   DISULFID   2456   2484       {ECO:0000250}.
FT   DISULFID   2569   2610       {ECO:0000250}.
FT   DISULFID   2596   2627       {ECO:0000250}.
FT   DISULFID   2632   2674       {ECO:0000250}.
FT   DISULFID   2658   2689       {ECO:0000250}.
FT   DISULFID   2694   2739       {ECO:0000250}.
FT   DISULFID   2725   2754       {ECO:0000250}.
FT   DISULFID   2759   2799       {ECO:0000250}.
FT   DISULFID   2785   2812       {ECO:0000250}.
FT   DISULFID   2817   2857       {ECO:0000250}.
FT   DISULFID   2843   2870       {ECO:0000250}.
FT   DISULFID   2875   2915       {ECO:0000250}.
FT   DISULFID   2901   2928       {ECO:0000250}.
FT   DISULFID   2933   2977       {ECO:0000250}.
FT   DISULFID   2963   2990       {ECO:0000250}.
FT   DISULFID   2995   3035       {ECO:0000250}.
FT   DISULFID   3021   3048       {ECO:0000250}.
FT   DISULFID   3056   3096       {ECO:0000250}.
FT   DISULFID   3082   3109       {ECO:0000250}.
FT   DISULFID   3114   3155       {ECO:0000250}.
FT   DISULFID   3141   3168       {ECO:0000250}.
FT   DISULFID   3173   3215       {ECO:0000250}.
FT   DISULFID   3199   3228       {ECO:0000250}.
FT   DISULFID   3233   3273       {ECO:0000250}.
FT   DISULFID   3259   3286       {ECO:0000250}.
FT   DISULFID   3291   3331       {ECO:0000250}.
FT   DISULFID   3317   3344       {ECO:0000250}.
FT   DISULFID   3352   3393       {ECO:0000250}.
FT   DISULFID   3379   3406       {ECO:0000250}.
FT   DISULFID   3411   3453       {ECO:0000250}.
FT   DISULFID   3438   3466       {ECO:0000250}.
FT   VAR_SEQ       1     59       MKGIRKGESRAKESKPWEPGKRRCAKCGRLDFILMKKMGIK
FT                                SGFTFWNLVFLLTVSCVK -> MWSWFLCWKPVQLDRQTAS
FT                                (in isoform 2).
FT                                {ECO:0000303|PubMed:12943675}.
FT                                /FTId=VSP_009047.
FT   VAR_SEQ     344    447       Missing (in isoform 3).
FT                                {ECO:0000303|PubMed:12906867}.
FT                                /FTId=VSP_009048.
FT   VAR_SEQ    1799   1868       Missing (in isoform 4).
FT                                {ECO:0000303|PubMed:11572484}.
FT                                /FTId=VSP_009050.
FT   VAR_SEQ    2629   2675       AISCGIPKAPTNGGILTTDYLVGTRVTYFCNDGYRLSSKEL
FT                                TTAVCQ -> GEVYYAKMNKNMNVRLAPFNVFIWITHFSEN
FT                                GNIRKHIVNSFHKNKA (in isoform 5).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_009051.
FT   VAR_SEQ    2676   3707       Missing (in isoform 5).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_009052.
FT   VAR_SEQ    2692   2756       Missing (in isoform 3).
FT                                {ECO:0000303|PubMed:12906867}.
FT                                /FTId=VSP_009049.
FT   VARIANT     219    219       I -> M (in dbSNP:rs2219898).
FT                                {ECO:0000269|PubMed:12943675}.
FT                                /FTId=VAR_017404.
FT   VARIANT     322    322       W -> G (in a colorectal cancer sample;
FT                                somatic mutation).
FT                                {ECO:0000269|PubMed:16959974}.
FT                                /FTId=VAR_035688.
FT   VARIANT    2020   2020       S -> C (found in a renal cell carcinoma
FT                                case; somatic mutation).
FT                                {ECO:0000269|PubMed:21248752}.
FT                                /FTId=VAR_064703.
FT   VARIANT    3000   3000       V -> L (in dbSNP:rs2193430).
FT                                /FTId=VAR_017405.
FT   VARIANT    3079   3079       R -> H (in a colorectal cancer sample;
FT                                somatic mutation; dbSNP:rs780986269).
FT                                {ECO:0000269|PubMed:16959974}.
FT                                /FTId=VAR_035689.
FT   VARIANT    3359   3359       R -> Q (in a colorectal cancer sample;
FT                                somatic mutation; dbSNP:rs139968762).
FT                                {ECO:0000269|PubMed:16959974}.
FT                                /FTId=VAR_035690.
FT   VARIANT    3621   3621       N -> H (in dbSNP:rs1592624).
FT                                {ECO:0000269|PubMed:12943675}.
FT                                /FTId=VAR_017406.
FT   CONFLICT    510    510       F -> L (in Ref. 1; AAO34702).
FT                                {ECO:0000305}.
FT   CONFLICT    726    726       T -> A (in Ref. 1; AAO34702).
FT                                {ECO:0000305}.
FT   CONFLICT    977    977       S -> I (in Ref. 3; BAB67787).
FT                                {ECO:0000305}.
FT   CONFLICT   2104   2104       I -> T (in Ref. 1; AAO34702).
FT                                {ECO:0000305}.
SQ   SEQUENCE   3707 AA;  406000 MW;  3194CBF8FE56ED76 CRC64;
     MKGIRKGESR AKESKPWEPG KRRCAKCGRL DFILMKKMGI KSGFTFWNLV FLLTVSCVKG
     FIYTCGGTLK GLNGTIESPG FPYGYPNGAN CTWVIIAEER NRIQIVFQSF ALEEEYDYLS
     LYDGHPHPTN FRTRLTGFHL PPPVTSTKSV FSLRLTSDFA VSAHGFKVYY EELQSSSCGN
     PGVPPKGVLY GTRFDVGDKI RYSCVTGYIL DGHPQLTCIA NSVNTASWDF PVPICRAEDA
     CGGTMRGSSG IISSPSFPNE YHNNADCTWT IVAEPGDTIS LIFTDFQMEE KYDYLEIEGS
     EPPTIWLSGM NIPPPIISNK NWLRLHFVTD SNHRYRGFSA PYQGSSTLTH TTSTGELEEH
     NRTTTGAIAV ASTPADVTVS SVTAVTIHRL SEEQRVQVTS LRNSGLDPNT SKDGLSPHPA
     DTQSTRRRPR HAEQIERTKE LAVVTHRVKK AIDFKSRGFK LFPGKDNSNK FSILNEGGIK
     TASNLCPDPG EPENGKRIGS DFSLGSTVQF SCDEDYVLQG AKSITCQRIA EVFAAWSDHR
     PVCKVKTCGS NLQGPSGTFT SPNFPFQYDS NAQCVWVITA VNTNKVIQIN FEEFDLEIGY
     DTLTIGDGGE VGDPRTVLQV LTGSFVPDLI VSMSSQMWLH LQTDESVGSV GFKVNYKEIE
     KESCGDPGTP LYGIREGDGF SNRDVLRFEC QFGFELIGEK SIVCQENNQW SANIPICIFP
     CLSNFTAPMG TVLSPDYPEG YGNNLNCIWT IISDPGSRIH LSFNDFDLES QFDFLAVKDG
     DSPESPILGT FTGAEVPSHL TSNSHILRLE FQADHSMSGR GFNITYNTFG HNECPDPGIP
     INARRFGDNF QLGSSISVIC EEGFIKTQGT ETITCILMDG KVMWSGLIPK CGAPCGGHFS
     APSGVILSPG WPGYYKDSLN CEWVIEAEPG HSIKITFERF QTELNYDVLE VHDGPNLLSP
     LLGSYNGTQV PQFLFSSSNF IYLLFTTDNS RSNNGFKIHY ESVTVNTYSC LDPGIPVHGR
     RYGHDFSIGS TVSFSCDSGY RLSHEEPLLC EKNHWWSHPL PTCDALCGGD VRGPSGTILS
     PGYPEFYPNS LNCTWTVDVT HGKGVQFNFH TFHLEDHHDY LLITENGSFT QPLARLTGSD
     LPPTINAGLY GNFRAQLRFI SDFSISYEGF NITFSEYNLE PCEDPGIPQY GSRIGFNFGI
     GDTLTFSCSS GYRLEGTSEI ICLGGGRRVW SAPLPRCVAE CGASATNNEG ILLSPNYPLN
     YENNHECIYS IQVQAGKGIN ISARTFHLAQ GDVLKIYDGK DKTTHLLGAF TGASMRGLTL
     SSTSNQLWLE FNSDTEGTDE GFQLVYTSFE LSHCEDPGIP QFGYKISDQG HFAGSTIIYG
     CNPGYTLHGS SLLKCMTGER RAWDYPLPSC IAECGGRFKG ESSGRILSPG YPFPYDNNLR
     CMWMIEVDPG NIVSLQFLAF DTEASHDILR VWDGPPENDM LLKEISGSLI PEGIHSTLNI
     VTIQFDTDFY ISKSGFAIQF SSSVATACRD PGVPMNGTRN GDGREPGDTV VFQCDPGYEL
     QGEERITCIQ VENRYFWQPS PPVCIAPCGG NLTGSSGFIL SPNFPHPYPH SRDCDWTITV
     NADYVISLAF ISFSIEPNYD FLYIYDGPDS NSPLIGSFQD SKLPERIESS SNTMHLAFRS
     DGSVSYTGFH LEYKAKLRES CFDPGNIMNG TRLGMDYKLG STVTYYCDAG YVLQGYSTLT
     CIMGDDGRPG WNRALPSCHA PCGSRSTGSE GTVLSPNYPK NYSVGHNCVY SIAVPKEFVV
     FGQFVFFQTS LHDVVEVYDG PTQQSSLLSS LSGSHSGESL PLSSGNQITI RFTSVGPITA
     KGFHFVYQAV PRTSSTQCSS VPEPRFGRRI GNEFAVGSSV LFDCNPGYIL HGSIAIRCET
     VPNSLAQWND SLPTCIVPCG GILTKRKGTI LSPGYPEPYD NNLNCVWKIT VPEGAGIQVQ
     VVSFATEHNW DSLDFYDGGD NNAPRLGSYS GTTIPHLLNS TSNNLYLNFQ SDISVSAAGF
     HLEYTAIGLD SCPEPQTPSS GIKIGDRYMV GDVVSFQCDQ GYSLQGHSHI TCMPGPVRRW
     NYPIPICLAQ CGGAMSDFSG VILSPGFPGN YPSSLDCTWT INLPIGFGVH LQFVNFSTET
     IHDYLEVRSG SSETSTVIGR LSGPQIPSSL FSTTHETSLY FHSDYSQNKQ GFHIVYQAYQ
     LQSCPDPRPF RNGFVIGNDF TVGQTISFEC FPGYTLIGNS ALTCLHGVSR NWNHPLPRCE
     ALCGGNITAM NGTIYSPGYP DEYPNFQDCF WLVRVPPGNG IYINFTVLQT EPIYDFITVW
     DGPDQNSPQI GQFSGNTALE SVYSTSNQIL IKFHSDFTTS GFFVLSYHAY QLRVCQPPPP
     VPNAEILTED DEFEIGDIIR YQCLPGFTLV GNAILTCRLG ERLQMDGAPP VCQVLCPANE
     LRLDSTGVIL SPGYPDSYPN LQMCAWSISV EKGYNITMFV EFFQTEKEFD VLQVYDGPNI
     QSPVLISLSG DYSSAFNITS NGHEVFLQWS ADHGNNKKGF RIRYIAFYCS TPESPPHGYI
     ISQTGGQLNS VVRWACDRGF RLVGKSSAVC RKSSYGYHAW DAPVPACQAI SCGIPKAPTN
     GGILTTDYLV GTRVTYFCND GYRLSSKELT TAVCQSDGTW SNHNKTPRCV VVTCPSINSF
     ILEHGRWRIV NGSHYEYKTK VVFSCDPGYH GLGPASIECL PNGTWSWRNE RPYCQIISCG
     ELPTPPNGNK IGTQTSYGST AIFTCDLGFM LVGSAVRECL SSGLWSESET RCLAGHCGIP
     ELIVNGQVIG ENYGYRDTVV YQCNPGFRLI GSSVRICQQD HNWSGQLPSC VPVSCGHPGS
     PIYGRTSGNG FNFNDVVTFS CNIGYLMQGP TKAQCQANRQ WSHPPPMCKV VNCSDPGIPA
     NSKRESKIEH GNFTYGTVVF YDCNPGYFLF GSSVLICQPN GQWDKPLPEC IMIDCGHPGV
     PPNAVLSGEK YTFGSTVHYS CTGKRSLLGQ SSRTCQLNGH WSGSQPHCSG DATGTCGDPG
     TPGHGSRQES NFRTKSTVRY ACDTGYILHG SEERTCLANG SWTGRQPECK AVQCGNPGTT
     ANGKVFRIDG TTFSSSVIYS CMEGYILSGP SVRQCTANGT WSGTLPNCTI ISCGDPGIPA
     NGLRYGDDYV VGQNVSYMCQ PGYTMELNGS RIRTCTINGT WSGVMPTCRA VTCPTPPQIS
     NGRLEGTNFD WGFSISYICS PGYELSFPAV LTCVGNGTWS GEVPQCLPKF CGDPGIPAQG
     KREGKSFIYQ SEVSFSCNFP FILVGSSTRI CQADGTWSGS SPHCIEPTQT SCENPGVPRH
     GSQNNTFGFQ VGSVVQFHCK KGHLLQGSTT RTCLPDLTWS GIQPECIPHS CKQPETPAHA
     NVVGMDLPSH GYTLIYTCQP GFFLAGGTEH RVCRSDNTWT GKVPICEAGS KILVKDPRPA
     LGTPSPKLSV PDDVFAQNYI WKGSYNFKGR KQPMTLTVTS FNASTGRVNA TLSNSNMELL
     LSGVYKSQEA RLMLRIYLIK VPAHASVKKM KEENWAMDGF VSAEPDGATY VFQGFIQGKD
     YGQFGLQRLG LNMSEGSNSS NQPHGTNSSS VAIAILVPFF ALIFAGFGFY LYKQRTAPKT
     QYTGCSVHEN NNGQAAFENP MYDTNAKSVE GKAVRFDPNL NTVCTMV
//
DBGET integrated database retrieval system