GenomeNet

Database: UniProt
Entry: Q8C088
LinkDB: Q8C088
Original site: Q8C088 
ID   EGFEM_MOUSE             Reviewed;         590 AA.
AC   Q8C088; B7ZCE8; Q149G1;
DT   10-JUN-2008, integrated into UniProtKB/Swiss-Prot.
DT   01-MAR-2003, sequence version 1.
DT   16-JAN-2019, entry version 121.
DE   RecName: Full=EGF-like and EMI domain-containing protein 1;
DE   Flags: Precursor;
GN   Name=Egfem1;
OS   Mus musculus (Mouse).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
OC   Muroidea; Muridae; Murinae; Mus; Mus.
OX   NCBI_TaxID=10090;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
RC   STRAIN=C57BL/6J; TISSUE=Medulla oblongata;
RX   PubMed=16141072; DOI=10.1126/science.1112014;
RA   Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
RA   Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
RA   Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
RA   Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
RA   Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
RA   Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
RA   Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
RA   Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
RA   di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
RA   Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
RA   Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
RA   Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
RA   Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
RA   Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
RA   Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
RA   Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
RA   Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
RA   Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
RA   Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
RA   Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
RA   Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
RA   Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
RA   Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
RA   Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
RA   Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
RA   Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
RA   Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
RA   Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
RA   Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
RA   Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
RA   Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
RA   Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
RA   Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
RA   Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
RA   Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
RA   Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
RA   Hayashizaki Y.;
RT   "The transcriptional landscape of the mammalian genome.";
RL   Science 309:1559-1563(2005).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=C57BL/6J;
RX   PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
RA   Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
RA   She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
RA   Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
RA   Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
RA   Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
RA   Lindblad-Toh K., Eichler E.E., Ponting C.P.;
RT   "Lineage-specific biology revealed by a finished genome assembly of
RT   the mouse.";
RL   PLoS Biol. 7:E1000112-E1000112(2009).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=Q8C088-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q8C088-2; Sequence=VSP_034213;
DR   EMBL; AK032017; BAC27650.1; -; mRNA.
DR   EMBL; AL691427; CAX16085.1; -; Genomic_DNA.
DR   EMBL; AC110222; CAX16085.1; JOINED; Genomic_DNA.
DR   EMBL; AC119240; CAX16085.1; JOINED; Genomic_DNA.
DR   EMBL; BC117810; AAI17811.1; -; mRNA.
DR   CCDS; CCDS50881.1; -. [Q8C088-1]
DR   CCDS; CCDS50882.1; -. [Q8C088-2]
DR   RefSeq; NP_001161220.1; NM_001167748.1. [Q8C088-2]
DR   UniGene; Mm.330948; -.
DR   ProteinModelPortal; Q8C088; -.
DR   SMR; Q8C088; -.
DR   STRING; 10090.ENSMUSP00000112943; -.
DR   PaxDb; Q8C088; -.
DR   PRIDE; Q8C088; -.
DR   Ensembl; ENSMUST00000118531; ENSMUSP00000112907; ENSMUSG00000063600. [Q8C088-2]
DR   GeneID; 75740; -.
DR   KEGG; mmu:75740; -.
DR   UCSC; uc008ouk.2; mouse. [Q8C088-2]
DR   CTD; 75740; -.
DR   MGI; MGI:1922990; Egfem1.
DR   eggNOG; KOG1218; Eukaryota.
DR   eggNOG; ENOG410XQWV; LUCA.
DR   GeneTree; ENSGT00940000164694; -.
DR   HOVERGEN; HBG069375; -.
DR   InParanoid; Q8C088; -.
DR   OrthoDB; 25795at2759; -.
DR   ChiTaRS; Egfem1; mouse.
DR   PRO; PR:Q8C088; -.
DR   Proteomes; UP000000589; Chromosome 3.
DR   Bgee; ENSMUSG00000063600; Expressed in 51 organ(s), highest expression level in brain.
DR   ExpressionAtlas; Q8C088; baseline and differential.
DR   GO; GO:0005509; F:calcium ion binding; IEA:InterPro.
DR   InterPro; IPR001881; EGF-like_Ca-bd_dom.
DR   InterPro; IPR013032; EGF-like_CS.
DR   InterPro; IPR000742; EGF-like_dom.
DR   InterPro; IPR000152; EGF-type_Asp/Asn_hydroxyl_site.
DR   InterPro; IPR018097; EGF_Ca-bd_CS.
DR   InterPro; IPR011489; EMI_domain.
DR   InterPro; IPR009030; Growth_fac_rcpt_cys_sf.
DR   Pfam; PF07645; EGF_CA; 2.
DR   Pfam; PF07546; EMI; 1.
DR   SMART; SM00181; EGF; 8.
DR   SMART; SM00179; EGF_CA; 5.
DR   SUPFAM; SSF57184; SSF57184; 1.
DR   PROSITE; PS00010; ASX_HYDROXYL; 3.
DR   PROSITE; PS00022; EGF_1; 4.
DR   PROSITE; PS01186; EGF_2; 6.
DR   PROSITE; PS50026; EGF_3; 4.
DR   PROSITE; PS01187; EGF_CA; 3.
DR   PROSITE; PS51041; EMI; 1.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Calcium; Complete proteome; Disulfide bond;
KW   EGF-like domain; Reference proteome; Repeat; Signal.
FT   SIGNAL        1     23       {ECO:0000255}.
FT   CHAIN        24    590       EGF-like and EMI domain-containing
FT                                protein 1.
FT                                /FTId=PRO_0000340647.
FT   DOMAIN       44    104       EMI. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00384}.
FT   DOMAIN      105    145       EGF-like 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00076}.
FT   DOMAIN      164    204       EGF-like 2; calcium-binding.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DOMAIN      205    244       EGF-like 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00076}.
FT   DOMAIN      245    285       EGF-like 4; calcium-binding.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DOMAIN      445    481       EGF-like 5. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00076}.
FT   DISULFID    109    125       {ECO:0000250}.
FT   DISULFID    135    144       {ECO:0000250}.
FT   DISULFID    168    179       {ECO:0000250}.
FT   DISULFID    175    188       {ECO:0000250}.
FT   DISULFID    190    203       {ECO:0000250}.
FT   DISULFID    209    219       {ECO:0000250}.
FT   DISULFID    215    228       {ECO:0000250}.
FT   DISULFID    230    243       {ECO:0000250}.
FT   DISULFID    249    260       {ECO:0000250}.
FT   DISULFID    256    269       {ECO:0000250}.
FT   DISULFID    271    284       {ECO:0000250}.
FT   DISULFID    449    462       {ECO:0000250}.
FT   DISULFID    456    469       {ECO:0000250}.
FT   DISULFID    471    480       {ECO:0000250}.
FT   VAR_SEQ     147    285       EKNKHLESELTPGFLQKNVDECAVVNGGCQQRCINTLGTFH
FT                                CECDTGYRRHADERTCIKTDPCAGANGCAHLCQTENGMARC
FT                                ACHAGYQLSEDKKACEDINECAGELAPCAHHCVNSKGSFTC
FT                                TCHPGFELGADRKHCY -> DINECAVDNGGCRDRCCNTIG
FT                                SYYCRCQAGQKLEEDGRGCEDVDECAVVNGGCQQRCINTLG
FT                                TFHCECDTGYRRHADERTCI (in isoform 2).
FT                                {ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_034213.
FT   CONFLICT    517    517       V -> A (in Ref. 3; AAI17811).
FT                                {ECO:0000305}.
SQ   SEQUENCE   590 AA;  65021 MW;  71EAB323CF34C4CF CRC64;
     MTSPLCFWCF CVWAAANWPP GSALQLQPGM PNVCREEQLT LVRLSRPCAQ AFIDTIQFWK
     QGCSGPRWCV GYERRIRYYI IYRHVYATEH QTVFRCCPGW IQWDDEPGCF SSLSSLGTHF
     SGRECSYQDT RQCLCSQGFH GPHCQYEKNK HLESELTPGF LQKNVDECAV VNGGCQQRCI
     NTLGTFHCEC DTGYRRHADE RTCIKTDPCA GANGCAHLCQ TENGMARCAC HAGYQLSEDK
     KACEDINECA GELAPCAHHC VNSKGSFTCT CHPGFELGAD RKHCYRIELE IVNICEKNNG
     GCSHHCEPAI GGAHCSCNHG HQLDTDGKTC IDFDECESGE ACCAQLCINY LGGYECSCEE
     GFQISSDGCG CDALDEQLEE EEEEIDILRF PGRLAQNPPQ PFPYLDPSLT ASYEDEDNDD
     ADSEAEGEVQ GLTALYRVVC LDGTFGLDCS LSCEDCMNGG RCQEGKSGCL CPAEWTGLIC
     NESSVLRTGE DQQAPAGCLK GFFGKNCKRK CHCANNVHCH RVYGACMCDL GRYGRFCHLS
     CPRGAYGASC SLECQCVEEN TLECSAKNGS CTCKSGYQGN RCQEELPLPA
//
DBGET integrated database retrieval system