GenomeNet

Database: UniProt
Entry: Q8CB67
LinkDB: Q8CB67
Original site: Q8CB67 
ID   LRP11_MOUSE             Reviewed;         483 AA.
AC   Q8CB67; Q8C7Y7;
DT   10-MAY-2004, integrated into UniProtKB/Swiss-Prot.
DT   01-MAR-2003, sequence version 1.
DT   08-MAY-2019, entry version 123.
DE   RecName: Full=Low-density lipoprotein receptor-related protein 11;
DE            Short=LRP-11;
DE   Flags: Precursor;
GN   Name=Lrp11;
OS   Mus musculus (Mouse).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
OC   Muroidea; Muridae; Murinae; Mus; Mus.
OX   NCBI_TaxID=10090;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
RC   STRAIN=C57BL/6J; TISSUE=Bone, and Cerebellum;
RX   PubMed=16141072; DOI=10.1126/science.1112014;
RA   Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
RA   Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
RA   Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
RA   Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
RA   Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
RA   Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
RA   Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
RA   Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
RA   di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
RA   Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
RA   Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
RA   Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
RA   Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
RA   Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
RA   Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
RA   Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
RA   Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
RA   Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
RA   Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
RA   Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
RA   Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
RA   Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
RA   Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
RA   Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
RA   Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
RA   Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
RA   Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
RA   Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
RA   Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
RA   Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
RA   Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
RA   Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
RA   Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
RA   Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
RA   Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
RA   Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
RA   Hayashizaki Y.;
RT   "The transcriptional landscape of the mammalian genome.";
RL   Science 309:1559-1563(2005).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
RC   STRAIN=C57BL/6J; TISSUE=Brain;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [3]
RP   PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-474, AND IDENTIFICATION
RP   BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
RC   TISSUE=Brain;
RX   PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
RA   Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
RA   Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
RT   "A tissue-specific atlas of mouse protein phosphorylation and
RT   expression.";
RL   Cell 143:1174-1189(2010).
CC   -!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type I
CC       membrane protein {ECO:0000305}.
CC   -!- SIMILARITY: Belongs to the LDLR family. {ECO:0000305}.
DR   EMBL; AK036676; BAC29532.1; -; mRNA.
DR   EMBL; AK048919; BAC33492.1; -; mRNA.
DR   EMBL; BC059874; -; NOT_ANNOTATED_CDS; mRNA.
DR   CCDS; CCDS23686.1; -.
DR   RefSeq; NP_766372.1; NM_172784.3.
DR   SMR; Q8CB67; -.
DR   STRING; 10090.ENSMUSP00000019931; -.
DR   iPTMnet; Q8CB67; -.
DR   PhosphoSitePlus; Q8CB67; -.
DR   MaxQB; Q8CB67; -.
DR   PaxDb; Q8CB67; -.
DR   PRIDE; Q8CB67; -.
DR   Ensembl; ENSMUST00000019931; ENSMUSP00000019931; ENSMUSG00000019796.
DR   Ensembl; ENSMUST00000229554; ENSMUSP00000155207; ENSMUSG00000116377.
DR   GeneID; 237253; -.
DR   KEGG; mmu:237253; -.
DR   UCSC; uc007ehw.2; mouse.
DR   CTD; 84918; -.
DR   MGI; MGI:2442989; Lrp11.
DR   eggNOG; ENOG410IIM4; Eukaryota.
DR   eggNOG; ENOG410XSFD; LUCA.
DR   GeneTree; ENSGT00940000161275; -.
DR   HOGENOM; HOG000113387; -.
DR   InParanoid; Q8CB67; -.
DR   OMA; RNHSAFW; -.
DR   OrthoDB; 993497at2759; -.
DR   PhylomeDB; Q8CB67; -.
DR   TreeFam; TF325867; -.
DR   ChiTaRS; Lrp11; mouse.
DR   PRO; PR:Q8CB67; -.
DR   Proteomes; UP000000589; Chromosome 10.
DR   Bgee; ENSMUSG00000019796; Expressed in 219 organ(s), highest expression level in islet of Langerhans.
DR   ExpressionAtlas; Q8CB67; baseline and differential.
DR   Genevisible; Q8CB67; MM.
DR   GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR   GO; GO:0051219; F:phosphoprotein binding; ISO:MGI.
DR   GO; GO:0006897; P:endocytosis; IEA:UniProtKB-KW.
DR   GO; GO:0033555; P:multicellular organismal response to stress; IEP:AgBase.
DR   GO; GO:0009409; P:response to cold; IEP:AgBase.
DR   GO; GO:0009408; P:response to heat; IEP:AgBase.
DR   GO; GO:0035902; P:response to immobilization stress; IEP:AgBase.
DR   GO; GO:0009612; P:response to mechanical stimulus; IEP:AgBase.
DR   GO; GO:0042594; P:response to starvation; IEP:AgBase.
DR   GO; GO:0009414; P:response to water deprivation; IEP:AgBase.
DR   CDD; cd00112; LDLa; 1.
DR   Gene3D; 2.60.40.10; -; 1.
DR   Gene3D; 4.10.400.10; -; 1.
DR   InterPro; IPR013783; Ig-like_fold.
DR   InterPro; IPR036055; LDL_receptor-like_sf.
DR   InterPro; IPR023415; LDLR_class-A_CS.
DR   InterPro; IPR002172; LDrepeatLR_classA_rpt.
DR   InterPro; IPR013980; MANSC_dom.
DR   InterPro; IPR011106; MANSC_N.
DR   InterPro; IPR035986; PKD_dom_sf.
DR   Pfam; PF00057; Ldl_recept_a; 1.
DR   Pfam; PF07502; MANEC; 1.
DR   SMART; SM00192; LDLa; 1.
DR   SMART; SM00765; MANEC; 1.
DR   SUPFAM; SSF49299; SSF49299; 1.
DR   SUPFAM; SSF57424; SSF57424; 1.
DR   PROSITE; PS01209; LDLRA_1; 1.
DR   PROSITE; PS50068; LDLRA_2; 1.
DR   PROSITE; PS50986; MANSC; 1.
PE   1: Evidence at protein level;
KW   Complete proteome; Disulfide bond; Endocytosis; Glycoprotein;
KW   Membrane; Phosphoprotein; Receptor; Reference proteome; Signal;
KW   Transmembrane; Transmembrane helix.
FT   SIGNAL        1     32       {ECO:0000255}.
FT   CHAIN        33    483       Low-density lipoprotein receptor-related
FT                                protein 11.
FT                                /FTId=PRO_0000017338.
FT   TOPO_DOM     33    433       Extracellular. {ECO:0000255}.
FT   TRANSMEM    434    456       Helical. {ECO:0000255}.
FT   TOPO_DOM    457    483       Cytoplasmic. {ECO:0000255}.
FT   DOMAIN       85    172       MANSC. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00341}.
FT   DOMAIN      193    287       PKD.
FT   DOMAIN      293    329       LDL-receptor class A.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   MOD_RES     474    474       Phosphoserine.
FT                                {ECO:0000244|PubMed:21183079}.
FT   CARBOHYD    152    152       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    275    275       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    403    403       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   DISULFID    294    306       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID    301    319       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   DISULFID    313    328       {ECO:0000255|PROSITE-ProRule:PRU00124}.
FT   CONFLICT     25     25       L -> H (in Ref. 1; BAC33492).
FT                                {ECO:0000305}.
FT   CONFLICT    241    241       K -> KLFVWQ (in Ref. 1; BAC33492).
FT                                {ECO:0000305}.
FT   CONFLICT    401    483       DSNSSGKNQEEGNYDLKSKSGQAGGEHPAPEAGAVLPLALG
FT                                LAITVLLLLMVTCRLRLVKQKLKKARPITSEESDYLINGMY
FT                                L -> AIPQERTKKKEIMISSPRVAKQEGSTRPRKQVRCYL
FT                                WH (in Ref. 2; BC059874). {ECO:0000305}.
SQ   SEQUENCE   483 AA;  51814 MW;  7AC8F124DD30CC82 CRC64;
     MATRGGGPGP GFRHRALRGL LLLCLWLPGS RPGEPAAPSS GVDRLLQDFR RQLQRARPRE
     ELEPELLGGP REDCPGAGGT AVYRAVPDTI IRTQDSIAAG ASFLRAPGSV RGWRQCVTAC
     CSEPSCSVAV VQLPRGPSVP APMPAPRCYL FNCTARGRSV CKFAPLRGYR TYTLSRAEDA
     AGIPPRPDED KPPVSKAGKD VVLHLPTDGV VLDGRESSDD HAIVLYEWTL QQGDPSSVDM
     KVPQPGTLRL SRLKEGAYIF QLTVTDSVGQ RSSDNVSVTV LPRPYSTGGC SSACSRYHFF
     CDSGCCIDIA LACDGVRQCP DGSDEDFCQN LALDRKLVTH TVATSAQPGA MGLNEGEGDP
     KLEKSQRATT HNQPATVSHP ETRIHSTQKA PESQINPVQP DSNSSGKNQE EGNYDLKSKS
     GQAGGEHPAP EAGAVLPLAL GLAITVLLLL MVTCRLRLVK QKLKKARPIT SEESDYLING
     MYL
//
DBGET integrated database retrieval system