GenomeNet

Database: UniProt
Entry: Q8K3K1
LinkDB: Q8K3K1
Original site: Q8K3K1 
ID   USH2A_RAT               Reviewed;        5125 AA.
AC   Q8K3K1; F1M2F9;
DT   04-APR-2006, integrated into UniProtKB/Swiss-Prot.
DT   05-DEC-2018, sequence version 2.
DT   10-APR-2019, entry version 98.
DE   RecName: Full=Usherin;
DE   AltName: Full=Usher syndrome type IIa protein homolog;
DE   AltName: Full=Usher syndrome type-2A protein homolog;
DE   Flags: Precursor;
GN   Name=Ush2a;
OS   Rattus norvegicus (Rat).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
OC   Muroidea; Muridae; Murinae; Rattus.
OX   NCBI_TaxID=10116;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING, AND
RP   TISSUE SPECIFICITY.
RX   PubMed=12160733; DOI=10.1006/geno.2002.6823;
RA   Huang D., Eudy J.D., Uzvolgyi E., Davis J.R., Talmadge C.B.,
RA   Pretto D., Weston M.D., Lehman J.E., Zhou M., Seemayer T.A., Ahmad I.,
RA   Kimberling W.J., Sumegi J.;
RT   "Identification of the mouse and rat orthologs of the gene mutated in
RT   Usher syndrome type IIA and the cellular source of USH2A mRNA in
RT   retina, a target tissue of the disease.";
RL   Genomics 80:195-203(2002).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=Brown Norway;
RX   PubMed=15057822; DOI=10.1038/nature02426;
RA   Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J.,
RA   Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G.,
RA   Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G.,
RA   Morgan M., Hawes A., Gill R., Holt R.A., Adams M.D., Amanatides P.G.,
RA   Baden-Tillson H., Barnstead M., Chin S., Evans C.A., Ferriera S.,
RA   Fosler C., Glodek A., Gu Z., Jennings D., Kraft C.L., Nguyen T.,
RA   Pfannkoch C.M., Sitter C., Sutton G.G., Venter J.C., Woodage T.,
RA   Smith D., Lee H.-M., Gustafson E., Cahill P., Kana A.,
RA   Doucette-Stamm L., Weinstock K., Fechtel K., Weiss R.B., Dunn D.M.,
RA   Green E.D., Blakesley R.W., Bouffard G.G., De Jong P.J., Osoegawa K.,
RA   Zhu B., Marra M., Schein J., Bosdet I., Fjell C., Jones S.,
RA   Krzywinski M., Mathewson C., Siddiqui A., Wye N., McPherson J.,
RA   Zhao S., Fraser C.M., Shetty J., Shatsman S., Geer K., Chen Y.,
RA   Abramzon S., Nierman W.C., Havlak P.H., Chen R., Durbin K.J., Egan A.,
RA   Ren Y., Song X.-Z., Li B., Liu Y., Qin X., Cawley S., Cooney A.J.,
RA   D'Souza L.M., Martin K., Wu J.Q., Gonzalez-Garay M.L., Jackson A.R.,
RA   Kalafus K.J., McLeod M.P., Milosavljevic A., Virk D., Volkov A.,
RA   Wheeler D.A., Zhang Z., Bailey J.A., Eichler E.E., Tuzun E.,
RA   Birney E., Mongin E., Ureta-Vidal A., Woodwark C., Zdobnov E.,
RA   Bork P., Suyama M., Torrents D., Alexandersson M., Trask B.J.,
RA   Young J.M., Huang H., Wang H., Xing H., Daniels S., Gietzen D.,
RA   Schmidt J., Stevens K., Vitt U., Wingrove J., Camara F., Mar Alba M.,
RA   Abril J.F., Guigo R., Smit A., Dubchak I., Rubin E.M., Couronne O.,
RA   Poliakov A., Huebner N., Ganten D., Goesele C., Hummel O.,
RA   Kreitler T., Lee Y.-A., Monti J., Schulz H., Zimdahl H.,
RA   Himmelbauer H., Lehrach H., Jacob H.J., Bromberg S.,
RA   Gullings-Handley J., Jensen-Seaman M.I., Kwitek A.E., Lazar J.,
RA   Pasko D., Tonellato P.J., Twigger S., Ponting C.P., Duarte J.M.,
RA   Rice S., Goodstadt L., Beatson S.A., Emes R.D., Winter E.E.,
RA   Webber C., Brandt P., Nyakatura G., Adetobi M., Chiaromonte F.,
RA   Elnitski L., Eswara P., Hardison R.C., Hou M., Kolbe D., Makova K.,
RA   Miller W., Nekrutenko A., Riemer C., Schwartz S., Taylor J., Yang S.,
RA   Zhang Y., Lindpaintner K., Andrews T.D., Caccamo M., Clamp M.,
RA   Clarke L., Curwen V., Durbin R.M., Eyras E., Searle S.M., Cooper G.M.,
RA   Batzoglou S., Brudno M., Sidow A., Stone E.A., Payseur B.A.,
RA   Bourque G., Lopez-Otin C., Puente X.S., Chakrabarti K., Chatterji S.,
RA   Dewey C., Pachter L., Bray N., Yap V.B., Caspi A., Tesler G.,
RA   Pevzner P.A., Haussler D., Roskin K.M., Baertsch R., Clawson H.,
RA   Furey T.S., Hinrichs A.S., Karolchik D., Kent W.J., Rosenbloom K.R.,
RA   Trumbower H., Weirauch M., Cooper D.N., Stenson P.D., Ma B., Brent M.,
RA   Arumugam M., Shteynberg D., Copley R.R., Taylor M.S., Riethman H.,
RA   Mudunuri U., Peterson J., Guyer M., Felsenfeld A., Old S., Mockrin S.,
RA   Collins F.S.;
RT   "Genome sequence of the Brown Norway rat yields insights into
RT   mammalian evolution.";
RL   Nature 428:493-521(2004).
RN   [3]
RP   TISSUE SPECIFICITY.
RX   PubMed=16301216; DOI=10.1093/hmg/ddi417;
RA   Reiners J., van Wijk E., Maerker T., Zimmermann U., Juergens K.,
RA   te Brinke H., Overlack N., Roepman R., Knipper M., Kremer H.,
RA   Wolfrum U.;
RT   "Scaffold protein harmonin (USH1C) provides molecular links between
RT   Usher syndrome type 1 and type 2.";
RL   Hum. Mol. Genet. 14:3933-3943(2005).
CC   -!- FUNCTION: Involved in hearing and vision as member of the USH2
CC       complex. In the inner ear, required for the hair bundle ankle
CC       formation, which connects growing stereocilia in developing
CC       cochlear hair cells. In retina photoreceptors, the USH2 complex is
CC       required for the maintenance of periciliary membrane complex that
CC       seems to play a role in regulating intracellular protein
CC       transport. {ECO:0000250|UniProtKB:Q2QI47}.
CC   -!- SUBUNIT: Interacts with collagen IV and fibronectin via its
CC       laminin EGF-like domains. Interaction with collagen may be
CC       required for stable integration into the basement membrane.
CC       Interacts with NINL (By similarity). Interacts with USH1C.
CC       Interacts (via the cytoplasmic region) with PDZD7. Component of
CC       USH2 complex, composed of ADGRV1, PDZD7, USH2A and WHRN. Interacts
CC       with ADGRV1/MASS1 (via N-terminal PDZ domain). Interacts (via the
CC       cytoplasmic region) with WHRN. Interacts (via the cytoplasmic
CC       region) with VEZT and MYO7A (via MyTH4-FERM domains); the
CC       interaction associates VEZT with the USH2 complex at the
CC       stereocilia base (By similarity). {ECO:0000250|UniProtKB:O75445,
CC       ECO:0000250|UniProtKB:Q2QI47}.
CC   -!- SUBCELLULAR LOCATION: Isoform 2: Secreted {ECO:0000250}.
CC   -!- SUBCELLULAR LOCATION: Cell projection, stereocilium membrane
CC       {ECO:0000250|UniProtKB:Q2QI47}. Photoreceptor inner segment
CC       {ECO:0000250|UniProtKB:Q2QI47}. Note=Component of the
CC       interstereocilia ankle links in the inner ear sensory cells. In
CC       photoreceptors, localizes at a plasma membrane microdomain in the
CC       apical inner segment taht surrounds the connecting cilia called
CC       periciliary membrane complex. {ECO:0000250|UniProtKB:Q2QI47}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC         Comment=A number of isoforms are produced.;
CC       Name=1;
CC         IsoId=Q8K3K1-2; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q8K3K1-1; Sequence=VSP_059945;
CC   -!- TISSUE SPECIFICITY: Present in the synaptic terminals of inner ear
CC       hair cells (at protein level). Predominantly expressed in the
CC       retina and cochlea. Weakly expressed in brain and kidney.
CC       Detectable from E17 in the neural epithelium, but not in the
CC       retinal pigment epithelium (RPE) of the developing retina. After
CC       birth, it is expressed at P7 and remains expressed during
CC       adulthood. {ECO:0000269|PubMed:12160733,
CC       ECO:0000269|PubMed:16301216}.
DR   EMBL; AY077844; AAL78289.1; -; mRNA.
DR   EMBL; AABR07022087; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AABR07022096; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AABR07022088; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AABR07022089; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AABR07022090; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AABR07022091; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AABR07022092; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AABR07022094; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AABR07022093; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AABR07022095; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   UniGene; Rn.200477; -.
DR   ProteinModelPortal; Q8K3K1; -.
DR   IntAct; Q8K3K1; 1.
DR   STRING; 10116.ENSRNOP00000004992; -.
DR   PhosphoSitePlus; Q8K3K1; -.
DR   PaxDb; Q8K3K1; -.
DR   PRIDE; Q8K3K1; -.
DR   UCSC; RGD:628777; rat. [Q8K3K1-2]
DR   RGD; 628777; Ush2a.
DR   eggNOG; KOG1836; Eukaryota.
DR   eggNOG; ENOG410XRDC; LUCA.
DR   InParanoid; Q8K3K1; -.
DR   PhylomeDB; Q8K3K1; -.
DR   PRO; PR:Q8K3K1; -.
DR   Proteomes; UP000002494; Unplaced.
DR   GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
DR   GO; GO:1990075; C:periciliary membrane compartment; ISS:UniProtKB.
DR   GO; GO:0001917; C:photoreceptor inner segment; IEA:UniProtKB-SubCell.
DR   GO; GO:0002141; C:stereocilia ankle link; ISS:UniProtKB.
DR   GO; GO:0002142; C:stereocilia ankle link complex; ISS:UniProtKB.
DR   GO; GO:0032420; C:stereocilium; IDA:RGD.
DR   GO; GO:0060171; C:stereocilium membrane; IEA:UniProtKB-SubCell.
DR   GO; GO:0045202; C:synapse; IDA:RGD.
DR   GO; GO:1990696; C:USH2 complex; ISS:UniProtKB.
DR   GO; GO:0045184; P:establishment of protein localization; ISS:UniProtKB.
DR   GO; GO:0050896; P:response to stimulus; IEA:UniProtKB-KW.
DR   GO; GO:0060041; P:retina development in camera-type eye; IEP:RGD.
DR   GO; GO:0007605; P:sensory perception of sound; IEA:UniProtKB-KW.
DR   GO; GO:0007601; P:visual perception; IEA:UniProtKB-KW.
DR   CDD; cd00063; FN3; 32.
DR   Gene3D; 2.60.120.1490; -; 1.
DR   Gene3D; 2.60.40.10; -; 33.
DR   InterPro; IPR013320; ConA-like_dom_sf.
DR   InterPro; IPR003961; FN3_dom.
DR   InterPro; IPR036116; FN3_sf.
DR   InterPro; IPR013783; Ig-like_fold.
DR   InterPro; IPR006558; LamG-like.
DR   InterPro; IPR002049; Laminin_EGF.
DR   InterPro; IPR001791; Laminin_G.
DR   InterPro; IPR008211; Laminin_N.
DR   InterPro; IPR038684; Laminin_N_sf.
DR   InterPro; IPR026915; USH2A.
DR   PANTHER; PTHR10574:SF274; PTHR10574:SF274; 16.
DR   Pfam; PF00041; fn3; 12.
DR   Pfam; PF00053; Laminin_EGF; 9.
DR   Pfam; PF00054; Laminin_G_1; 2.
DR   Pfam; PF00055; Laminin_N; 1.
DR   SMART; SM00180; EGF_Lam; 10.
DR   SMART; SM00060; FN3; 34.
DR   SMART; SM00282; LamG; 2.
DR   SMART; SM00560; LamGL; 1.
DR   SMART; SM00136; LamNT; 1.
DR   SUPFAM; SSF49265; SSF49265; 21.
DR   SUPFAM; SSF49899; SSF49899; 3.
DR   PROSITE; PS00022; EGF_1; 6.
DR   PROSITE; PS01248; EGF_LAM_1; 6.
DR   PROSITE; PS50027; EGF_LAM_2; 10.
DR   PROSITE; PS50853; FN3; 33.
DR   PROSITE; PS50025; LAM_G_DOMAIN; 2.
DR   PROSITE; PS51117; LAMININ_NTER; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; Cell membrane; Cell projection;
KW   Complete proteome; Disulfide bond; Glycoprotein; Hearing;
KW   Laminin EGF-like domain; Membrane; Reference proteome; Repeat;
KW   Secreted; Sensory transduction; Signal; Vision.
FT   SIGNAL        1     33       {ECO:0000255}.
FT   CHAIN        34   5125       Usherin.
FT                                /FTId=PRO_0000229806.
FT   DOMAIN      273    513       Laminin N-terminal. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00466}.
FT   DOMAIN      514    570       Laminin EGF-like 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00460}.
FT   DOMAIN      571    636       Laminin EGF-like 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00460}.
FT   DOMAIN      637    689       Laminin EGF-like 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00460}.
FT   DOMAIN      690    742       Laminin EGF-like 4. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00460}.
FT   DOMAIN      743    790       Laminin EGF-like 5. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00460}.
FT   DOMAIN      791    842       Laminin EGF-like 6. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00460}.
FT   DOMAIN      843    895       Laminin EGF-like 7. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00460}.
FT   DOMAIN      896    946       Laminin EGF-like 8. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00460}.
FT   DOMAIN      947    997       Laminin EGF-like 9. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00460}.
FT   DOMAIN      998   1048       Laminin EGF-like 10.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DOMAIN     1054   1142       Fibronectin type-III 1.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     1146   1240       Fibronectin type-III 2.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     1241   1356       Fibronectin type-III 3.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     1357   1461       Fibronectin type-III 4.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     1510   1697       Laminin G-like 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00122}.
FT   DOMAIN     1702   1879       Laminin G-like 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00122}.
FT   DOMAIN     1857   1943       Fibronectin type-III 5.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     1945   2042       Fibronectin type-III 6.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2043   2132       Fibronectin type-III 7.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2133   2230       Fibronectin type-III 8.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2231   2318       Fibronectin type-III 9.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2319   2421       Fibronectin type-III 10.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2425   2519       Fibronectin type-III 11.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2520   2613       Fibronectin type-III 12.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2614   2709       Fibronectin type-III 13.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2713   2806       Fibronectin type-III 14.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2807   2910       Fibronectin type-III 15.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     2914   3005       Fibronectin type-III 16.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     3009   3099       Fibronectin type-III 17.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     3380   3485       Fibronectin type-III 18.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     3486   3577       Fibronectin type-III 19.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     3580   3670       Fibronectin type-III 20.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     3672   3762       Fibronectin type-III 21.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     3765   3852       Fibronectin type-III 22.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     3853   3950       Fibronectin type-III 23.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     3951   4054       Fibronectin type-III 24.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     4055   4143       Fibronectin type-III 25.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     4144   4251       Fibronectin type-III 26.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     4252   4344       Fibronectin type-III 27.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     4345   4432       Fibronectin type-III 28.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     4433   4517       Fibronectin type-III 29.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     4518   4620       Fibronectin type-III 30.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     4625   4720       Fibronectin type-III 31.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     4721   4813       Fibronectin type-III 32.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   DOMAIN     4814   4916       Fibronectin type-III 33.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00316}.
FT   CARBOHYD    120    120       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    229    229       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    257    257       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    273    273       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    414    414       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    447    447       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    468    468       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    646    646       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    835    835       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    852    852       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    884    884       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    940    940       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1007   1007       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1067   1067       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1149   1149       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1170   1170       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1221   1221       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1304   1304       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD   1381   1381       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   DISULFID    514    523       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    516    532       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    534    545       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    548    568       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    571    580       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    573    601       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    604    613       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    616    634       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    637    651       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    639    658       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    660    669       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    672    687       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    690    704       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    692    711       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    713    722       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    725    740       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    743    755       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    745    762       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    764    773       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    776    788       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    791    804       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    793    811       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    813    822       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    825    840       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    843    857       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    845    864       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    866    875       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    878    893       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    896    909       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    898    916       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    918    927       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    930    944       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    947    959       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    949    966       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    981    995       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID    998   1010       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID   1000   1017       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID   1019   1028       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID   1031   1046       {ECO:0000255|PROSITE-ProRule:PRU00460}.
FT   DISULFID   1660   1697       {ECO:0000255|PROSITE-ProRule:PRU00122}.
FT   DISULFID   1850   1879       {ECO:0000255|PROSITE-ProRule:PRU00122}.
FT   VAR_SEQ    1457   5125       AAAPAQLRSPMVTGVTSTTVHIRWLPPAEVNGPPPLYRLER
FT                                RESFLPAATAARTKGTRFMGDGYCRFPRTAHPDFIGIKASF
FT                                WTRVPEGLILLALHPDNQEEYFALQLKSGRPYFLYNPQGSL
FT                                VEVTTADDHSQQYSDGQWHEITAIRHQSFGQITLDEQYTDS
FT                                SASLNGSSVTGGYTRLFVGGLPQGHTILQKRPVRRGFVGCL
FT                                KDVSILKGSSPSGTWLPLDWQSSEEQVNVHHSWEGCPTDLE
FT                                EGVQFLGAGFLELRSDTFHAAKDFEISLKFQTDQLNGLLLF
FT                                IHNTEGLDFLAMELKSGLLSFQLNSSRILTRVEVRLGRTHC
FT                                DGKWNRVTIRREGSMVSVGVNELTKSTSRAGDQPPLLTSPV
FT                                YLGGIPQELQASYRHLTLEQGFRGCVKEVAFTRGAVVNLAS
FT                                VSSRAVRVNQDGCLSSDSTVNCGGNDSILVYRGSRQSVYES
FT                                GLQPFTEYLYRVTASHKGGSVSSDWSRGRTLGSAPHSVPTP
FT                                SRAQSINGYSVEVAWNEPAMVKGVLEKYILKAYSEDSAQPH
FT                                MPSASTEFNNTDIRTGILTGLHPFHSYAVTLTACSRAGCTE
FT                                SSRALSISTPQEAPQEVQAPVAEALPNSLSFFWSPPRQANG
FT                                IITQYSLYMDGRLVYTGKGQNYTVTDLRVFTAYEITVGACT
FT                                RAGCTNSSRVILHTAQLPPERVDPPVLAILDSRTVHIQWKQ
FT                                PRQLNGILERYILYTLNPTHNSTVWDVVYNSTENLQTHLLY
FT                                HLSPGCLYLIKLGACTGGGCTTSEPSQALMDETVPEGVPAP
FT                                RAHSHSPDSFNISWTEPGHPNGVITTYELYLDGTLIHNSSE
FT                                LSCHAYGFDPGSLHTFQVQACTAKGCALGPLVENRTLEAPP
FT                                EGTVNLFVKPEGSREAAVRWDAPPHPNGRLTYSVLITGNFY
FT                                ADQAGDNYTLLSSTKTVHSSKGDRLWVLVDRLVPCSNYTVQ
FT                                VNASNSQGSVLSDRVSVEMPPGAPDGLLSPRLAAATPTSLQ
FT                                VVWSTPARNNAPGSPRYQLQMRPDPSTRGLLELFPIPSALL
FT                                SYEVTGLQPFTVYEFRLVATNGFGSAYSDWTPLMTTEDKPG
FT                                PMDAPVLNVKAGMMSVAWRKPTECNGAITHYNIYQHGRLYL
FT                                TVSGGVTNCTVVHLRPHTAYQFQIEACSSKGCSMSPASETV
FT                                WTLPGTPEGIPGPELLPYTPTKIIVSWQPPTHLDGLVENIT
FT                                IERRVKEQEEVRSLVILPRSQAVRFIDNDPALRPWTHYEYR
FT                                VLGSTLNGGTNSSAWVEVTTRPSRPSGVQPPTVHVLGPDAV
FT                                EVTWKAPLIRNGDIVSYEIRMPDPLIEITNVTSFVLSHLVK
FT                                HLIPFTNYSVSIVACSGGHGYLGGCTESLPTFATTHPALPQ
FT                                ELTPLSISLLGQSYVGISWQPPSKPNGPNLRYELLRRKIQQ
FT                                PLASNPPEDLNLWHNIYSGTRRFYEDKGLSRFTTYEYKLFV
FT                                HNSLGFTPSQEVTVTTLAGSPERGATVTASILNHTAIDVRW
FT                                KRPTFQDLQGDVEYYTLFWSSGTSVESLKIFPDVDFHVIGH
FT                                LAPNVEYQVFLLVFNGVHAINSTVVRVTTWEEEPRGMRPPE
FT                                VVIINSTAVRVIWTSPSNPNAVITESSVYANNELHKAGAGA
FT                                PGSFTLEDLSPFTIYDIQVEVCTKDACVKSSGTQVSTAEDT
FT                                PSGISIPIIRDITSRSLQIDWTAPGNPNGIILGYDVLRKTW
FT                                RLCSETQKLTDKPRDELCKAVKCQYPGNVCGHTCYSPGTKV
FT                                CCDGLLYDPQPGYSCCEEKYIALLPNSTGVCCGGRQREAQP
FT                                DHQCCSGHYIRILPGEICCPDERHNRVSVGFGDACCGTMPY
FT                                ATSGSQVCCAGKLQDGYRRQCCGGEMVSQDFKCCGGGEEGM
FT                                VYSSLPGMLCCGQDYVNMSDTICCSASSGDSKAHVRGSDPM
FT                                PVRCCHTELIPESQQCCDGVGYNPVKYVCSDEISAGMATEE
FT                                TRVCATVCPATMRATAHCGQCDFNATTHICTVSRGPLNPIG
FT                                KETAEGLCSTAEEIVHSGDENTRSFIDTDLEPSTVYEYRVS
FT                                VWNSYGRGFSQSVRASTREDVPQGVTAPRWARTGNHEDVIF
FT                                LTWKEPTQSNGPITHYILLRDGRERFQGAALSFTDTQGIQP
FT                                LQEYSYQLKACTAAGCADSCKVVATATRGVLESVPPPNITA
FT                                QSPETLHLSWSVPEKRNDAIKEYQLWLDGKGLIYTDTNDRR
FT                                QHTVTGLQPHTNYSFTLSACTSVGCTSSEPSVGQTLQAAPQ
FT                                GVWVTPRHIIINSTTVELYWNPPERPNGVISQYRLRRNGSL
FT                                LLVGGRDDQSFTDKNLEPNSRYIYTLEARTGGGSSLSEEYL
FT                                VQMPMWTPEDVHPPCNVTVLGSDSIFVAWPAPGILLPKIPV
FT                                EYSILLSGGNMMLLTFSVGLRQSAYLKNLAPFTQYEIRIQA
FT                                CQEGCGVSPGTHVRTLEAAPVGLMPPLLKALGSHCIEVKWT
FT                                PPTRPNGIITSYVIHRRPADTEEESLLFVWSEGALEFTDDT
FT                                DTLRPFTLYEYRVRAWNSKGVVDSPWSSVQTLEAPPQDLPA
FT                                PWVQVTSAHSVLLNWTEPEAPNGLISQYHVIYQERPDEAAP
FT                                GSSTVHAFTVKGSSRQAHLFGLEPFTTYHIGVAAVNRAGKV
FT                                SSPWTLIKTLESAPSGLMNFTAEQREGGRALLLQWSEPVRT
FT                                NGVIKAYNVFSDGLPEYSGLGRQFLFRRLAPFTLYILTLEA
FT                                CTAAGCAHSVPQTLWTEEAPPDSQMAPTIQSVEPTSVRLHW
FT                                SQPANPNGKIIRYEVIRRRLQGEDWGNRTVQADENTVFTEY
FT                                NTEGNGWVCTDTGLQPWGLYSYRICTWNSAGHTCSSWSVVR
FT                                TSQAPPDGLSPPEVSYVSTSPLQLLISWFAPRHTNGVIQSY
FT                                RLQRNGVFAAASFNSSTFSYTDGQLLPFTTYSYAVLACTGG
FT                                GCCTSEPTNITTPEASPAGVSPPVLWAIGAHQINVSWSPPS
FT                                VPNGKIAKYLLHCDGEEHLAGQDLSLLLSNLRPFTQYNVSL
FT                                VACTKGGCTASRVASAWTMEAPPEDMDPPTLHVMGPESIEI
FT                                TWAPPRNPHGQIRSYELRRDGAIVYIGLETRYHDFILTPGV
FT                                QYGYTVTATNSRGSVLSPLVKGQTSPSAPSGLQPPKLRAGE
FT                                ALELLVNWNPPVRTNGKITNYTLFIRELLEGEIRTMCINTT
FT                                HSSFGTRSLAVKHLKPFHRYEVRVQACTALGCTSSEWTPTQ
FT                                TSEIPPLLQPAPHLEVQTAAGGFQPIVAVWWAGPLQPHGKI
FT                                VRFELYRRQTASWPGTSSPLLIYNGSLSSFTDRELLPFTEY
FT                                EYQVWAVNSAGKVASNWTWCRTGPAPPEGLKAPTFHTVSST
FT                                QAVVNISAPSKPNGNISLFRVFSNSSGTHVMLSEGMATQQT
FT                                LHDLRPFTTYAIGVEACTCFNCCSRGPTAELRTHPAPPSGL
FT                                SPPQVQTLGSRMASFQWAPPQLPNGVIHSYELQLHRACPPD
FT                                SAPHCPPSPTERKYWGPGHRASLAGLQPNTAYGVQVVAHNE
FT                                AGSTASGWTSFRTKKEMPQYQALFSVDSNASTVWVDWSGTF
FT                                VLNGQLKEYVVTDGGRRVYSGLDTTLYIPRTVDKTFFFQVT
FT                                CTTDIGSVKTPLVQYDATTGFGLVLTTPGGKKGAGTKSTEF
FT                                YTDTRLPRSGTPVSIRSSQSVSVLRIPSQSQLSHAYSQGSL
FT                                HRSVSQLMDSPDKKALTEDSLWETIMGHSSGLCVDEEELMN
FT                                AIKGFSSVTKEHTAFTDTHL -> TAGKNVLTNTKKCTHVG
FT                                NQYYRSAVLWASYMSSLFTAPSSDILDVVYLESFKQNQH
FT                                (in isoform 2).
FT                                /FTId=VSP_059945.
FT   CONFLICT     52     52       S -> T (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    210    211       HT -> LS (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    221    221       S -> F (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    243    246       MDSV -> TDSA (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    439    439       E -> D (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    531    531       R -> Q (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    656    656       D -> G (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    686    686       C -> G (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    879    879       K -> E (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    887    890       MDNP -> VDNL (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    897    897       D -> E (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    905    908       LGSM -> PGST (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    924    939       ERRCVQCQPGCYSSPS -> GRRCERCQPGFYSSPG (in
FT                                Ref. 1; AAL78289). {ECO:0000305}.
FT   CONFLICT    948    957       LCHTVATKNC -> SCHTAGAVSH (in Ref. 1;
FT                                AAL78289). {ECO:0000305}.
FT   CONFLICT    965    969       HCYCP -> QCSCR (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    976    978       LSW -> QSC (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT    984    996       RYFRFDPLTGRCR -> HYFGFDPRTGRCQ (in Ref.
FT                                1; AAL78289). {ECO:0000305}.
FT   CONFLICT   1002   1012       VAGASNGTCDA -> LEGALNETCDV (in Ref. 1;
FT                                AAL78289). {ECO:0000305}.
FT   CONFLICT   1030   1030       T -> I (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT   1044   1045       LA -> FG (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
FT   CONFLICT   1441   1441       A -> Y (in Ref. 1; AAL78289).
FT                                {ECO:0000305}.
SQ   SEQUENCE   5125 AA;  562986 MW;  9CC58BA0D18511D0 CRC64;
     MYYLALSSGF LGQAIKTSIL AYLASVLLAA SQGVFPRLEN VGAFKKVSIV PSHATCGYPG
     PSTFCRSAVA AEHAQLCAER LCIQDCPYRS ASPPYTALLE GLRSCIPADH GDLHPYSRSN
     STSFIFGSHK NCPSLQAPRL AAEFTLAVWL KPERGSTMCV LEKTADGQIV FKVTISERET
     MFYYRTVNGL QPPIKVMTPG RILMKKWIHH TVQVHETEVS SFVDGLEENS TAFDTRTLRD
     SIMDSVPSTV LIGQSLNGSE LFVGRMQDFR LYNVSLTNRE ILELFSGDLP HLHIQSHCRC
     PGSHPRVHPS VQQYCIPNGV EDTLQHRVSR LNPEAHPLSF INDDDVATSW ISHVFTDITQ
     LNQGVAISID LENGQYQVFQ ITIRFSSPQP VAMRIQRKKA DKSLWEDWQY FARNCSVWGM
     KNNGDLENPN SVNCLQFPEF IPFSHGNVTF DLLTSGQKHR PGDYDFYNSS LLQEFMTATQ
     IRLYFRGLFY PAWHTVDSRH RYYAVDEITI IGRCQCHGHA ETCDRTRRPY RCLCSPHSFT
     EGPQCGRCSP LYNDKPFRSG NKVHAFNCKP CQCHGHASSC HYDASMDPFP LEYNRGGGGV
     CDDCQHHTTG RNCESCQDYF YRPIGADPAD PEVCKHCDCN RDGTRNGSLL CDLVGDQCDC
     KRRVSGRRCF RCHIGFYGLQ ALDPDCCRPC DCNPSGTVDG DITCHHNSGQ CSCKANVIGL
     RCDRCSFGFK FLRSLNADGC EPCHCNLHGS VNQLCDPLSG QCVCKKEAKG LRCDVCRENF
     YGLPWSACEV CDCNRAGTQA GTVCDAETGQ CVCKPSVGGR RCSECKEGYF NLRQNDSHLC
     LPCNCEKTGT VNGSLLCDKS TGQCPCKLGV TGLRCHQCKP HRFNLTMDNP QGCQACDCDS
     LGTLLGSMCD PVSGQCLCLP HRQERRCVQC QPGCYSSPSN ATGCLPCLCH TVATKNCICN
     SVTGHCYCPD PSTTGLSWHQ CQDRYFRFDP LTGRCRPCHC HVAGASNGTC DAVTGQCFCK
     EFVTGSKCDT CVPGASHLDV NNLLACSKTP SQQPPPRGRV QSSSAINLSW SPPDFPNAHW
     LTYTLFRDDS EIYTTDDQHP YYTQYFLDTS LSPHTAYSYY IETSNVHSST RSIPVIYKTK
     PEGSEGHLNL THIIPVASDS ITLVWTGLSN HSGPIEKYVL SCTPVDHTEP CVSYEGPETS
     ATIRNLVPFT QYCFSVQGCT NGSCLYSSPI TVTTAQAPPQ RQEPPTVWKI SPTELKVEWS
     RPVDSNGVII RYELYMKRWP STEESLVFES HGWFHSHPAS PSANQSENVL QDPQVSTVLS
     GLDPHTEYAF RVLAVNMAGS VSSAWASERT GESAPVFMAA PSVSPLSPYS LSVSWEKPAE
     NFTRGEIIGY KISMVSERSP QRDVPVMCSK LVHFAESQDQ SYIVQRLKPY RTYSFTVSLC
     ASVGCVTSAL GEGQTLAAAP AQLRSPMVTG VTSTTVHIRW LPPAEVNGPP PLYRLERRES
     FLPAATAART KGTRFMGDGY CRFPRTAHPD FIGIKASFWT RVPEGLILLA LHPDNQEEYF
     ALQLKSGRPY FLYNPQGSLV EVTTADDHSQ QYSDGQWHEI TAIRHQSFGQ ITLDEQYTDS
     SASLNGSSVT GGYTRLFVGG LPQGHTILQK RPVRRGFVGC LKDVSILKGS SPSGTWLPLD
     WQSSEEQVNV HHSWEGCPTD LEEGVQFLGA GFLELRSDTF HAAKDFEISL KFQTDQLNGL
     LLFIHNTEGL DFLAMELKSG LLSFQLNSSR ILTRVEVRLG RTHCDGKWNR VTIRREGSMV
     SVGVNELTKS TSRAGDQPPL LTSPVYLGGI PQELQASYRH LTLEQGFRGC VKEVAFTRGA
     VVNLASVSSR AVRVNQDGCL SSDSTVNCGG NDSILVYRGS RQSVYESGLQ PFTEYLYRVT
     ASHKGGSVSS DWSRGRTLGS APHSVPTPSR AQSINGYSVE VAWNEPAMVK GVLEKYILKA
     YSEDSAQPHM PSASTEFNNT DIRTGILTGL HPFHSYAVTL TACSRAGCTE SSRALSISTP
     QEAPQEVQAP VAEALPNSLS FFWSPPRQAN GIITQYSLYM DGRLVYTGKG QNYTVTDLRV
     FTAYEITVGA CTRAGCTNSS RVILHTAQLP PERVDPPVLA ILDSRTVHIQ WKQPRQLNGI
     LERYILYTLN PTHNSTVWDV VYNSTENLQT HLLYHLSPGC LYLIKLGACT GGGCTTSEPS
     QALMDETVPE GVPAPRAHSH SPDSFNISWT EPGHPNGVIT TYELYLDGTL IHNSSELSCH
     AYGFDPGSLH TFQVQACTAK GCALGPLVEN RTLEAPPEGT VNLFVKPEGS REAAVRWDAP
     PHPNGRLTYS VLITGNFYAD QAGDNYTLLS STKTVHSSKG DRLWVLVDRL VPCSNYTVQV
     NASNSQGSVL SDRVSVEMPP GAPDGLLSPR LAAATPTSLQ VVWSTPARNN APGSPRYQLQ
     MRPDPSTRGL LELFPIPSAL LSYEVTGLQP FTVYEFRLVA TNGFGSAYSD WTPLMTTEDK
     PGPMDAPVLN VKAGMMSVAW RKPTECNGAI THYNIYQHGR LYLTVSGGVT NCTVVHLRPH
     TAYQFQIEAC SSKGCSMSPA SETVWTLPGT PEGIPGPELL PYTPTKIIVS WQPPTHLDGL
     VENITIERRV KEQEEVRSLV ILPRSQAVRF IDNDPALRPW THYEYRVLGS TLNGGTNSSA
     WVEVTTRPSR PSGVQPPTVH VLGPDAVEVT WKAPLIRNGD IVSYEIRMPD PLIEITNVTS
     FVLSHLVKHL IPFTNYSVSI VACSGGHGYL GGCTESLPTF ATTHPALPQE LTPLSISLLG
     QSYVGISWQP PSKPNGPNLR YELLRRKIQQ PLASNPPEDL NLWHNIYSGT RRFYEDKGLS
     RFTTYEYKLF VHNSLGFTPS QEVTVTTLAG SPERGATVTA SILNHTAIDV RWKRPTFQDL
     QGDVEYYTLF WSSGTSVESL KIFPDVDFHV IGHLAPNVEY QVFLLVFNGV HAINSTVVRV
     TTWEEEPRGM RPPEVVIINS TAVRVIWTSP SNPNAVITES SVYANNELHK AGAGAPGSFT
     LEDLSPFTIY DIQVEVCTKD ACVKSSGTQV STAEDTPSGI SIPIIRDITS RSLQIDWTAP
     GNPNGIILGY DVLRKTWRLC SETQKLTDKP RDELCKAVKC QYPGNVCGHT CYSPGTKVCC
     DGLLYDPQPG YSCCEEKYIA LLPNSTGVCC GGRQREAQPD HQCCSGHYIR ILPGEICCPD
     ERHNRVSVGF GDACCGTMPY ATSGSQVCCA GKLQDGYRRQ CCGGEMVSQD FKCCGGGEEG
     MVYSSLPGML CCGQDYVNMS DTICCSASSG DSKAHVRGSD PMPVRCCHTE LIPESQQCCD
     GVGYNPVKYV CSDEISAGMA TEETRVCATV CPATMRATAH CGQCDFNATT HICTVSRGPL
     NPIGKETAEG LCSTAEEIVH SGDENTRSFI DTDLEPSTVY EYRVSVWNSY GRGFSQSVRA
     STREDVPQGV TAPRWARTGN HEDVIFLTWK EPTQSNGPIT HYILLRDGRE RFQGAALSFT
     DTQGIQPLQE YSYQLKACTA AGCADSCKVV ATATRGVLES VPPPNITAQS PETLHLSWSV
     PEKRNDAIKE YQLWLDGKGL IYTDTNDRRQ HTVTGLQPHT NYSFTLSACT SVGCTSSEPS
     VGQTLQAAPQ GVWVTPRHII INSTTVELYW NPPERPNGVI SQYRLRRNGS LLLVGGRDDQ
     SFTDKNLEPN SRYIYTLEAR TGGGSSLSEE YLVQMPMWTP EDVHPPCNVT VLGSDSIFVA
     WPAPGILLPK IPVEYSILLS GGNMMLLTFS VGLRQSAYLK NLAPFTQYEI RIQACQEGCG
     VSPGTHVRTL EAAPVGLMPP LLKALGSHCI EVKWTPPTRP NGIITSYVIH RRPADTEEES
     LLFVWSEGAL EFTDDTDTLR PFTLYEYRVR AWNSKGVVDS PWSSVQTLEA PPQDLPAPWV
     QVTSAHSVLL NWTEPEAPNG LISQYHVIYQ ERPDEAAPGS STVHAFTVKG SSRQAHLFGL
     EPFTTYHIGV AAVNRAGKVS SPWTLIKTLE SAPSGLMNFT AEQREGGRAL LLQWSEPVRT
     NGVIKAYNVF SDGLPEYSGL GRQFLFRRLA PFTLYILTLE ACTAAGCAHS VPQTLWTEEA
     PPDSQMAPTI QSVEPTSVRL HWSQPANPNG KIIRYEVIRR RLQGEDWGNR TVQADENTVF
     TEYNTEGNGW VCTDTGLQPW GLYSYRICTW NSAGHTCSSW SVVRTSQAPP DGLSPPEVSY
     VSTSPLQLLI SWFAPRHTNG VIQSYRLQRN GVFAAASFNS STFSYTDGQL LPFTTYSYAV
     LACTGGGCCT SEPTNITTPE ASPAGVSPPV LWAIGAHQIN VSWSPPSVPN GKIAKYLLHC
     DGEEHLAGQD LSLLLSNLRP FTQYNVSLVA CTKGGCTASR VASAWTMEAP PEDMDPPTLH
     VMGPESIEIT WAPPRNPHGQ IRSYELRRDG AIVYIGLETR YHDFILTPGV QYGYTVTATN
     SRGSVLSPLV KGQTSPSAPS GLQPPKLRAG EALELLVNWN PPVRTNGKIT NYTLFIRELL
     EGEIRTMCIN TTHSSFGTRS LAVKHLKPFH RYEVRVQACT ALGCTSSEWT PTQTSEIPPL
     LQPAPHLEVQ TAAGGFQPIV AVWWAGPLQP HGKIVRFELY RRQTASWPGT SSPLLIYNGS
     LSSFTDRELL PFTEYEYQVW AVNSAGKVAS NWTWCRTGPA PPEGLKAPTF HTVSSTQAVV
     NISAPSKPNG NISLFRVFSN SSGTHVMLSE GMATQQTLHD LRPFTTYAIG VEACTCFNCC
     SRGPTAELRT HPAPPSGLSP PQVQTLGSRM ASFQWAPPQL PNGVIHSYEL QLHRACPPDS
     APHCPPSPTE RKYWGPGHRA SLAGLQPNTA YGVQVVAHNE AGSTASGWTS FRTKKEMPQY
     QALFSVDSNA STVWVDWSGT FVLNGQLKEY VVTDGGRRVY SGLDTTLYIP RTVDKTFFFQ
     VTCTTDIGSV KTPLVQYDAT TGFGLVLTTP GGKKGAGTKS TEFYTDTRLP RSGTPVSIRS
     SQSVSVLRIP SQSQLSHAYS QGSLHRSVSQ LMDSPDKKAL TEDSLWETIM GHSSGLCVDE
     EELMNAIKGF SSVTKEHTAF TDTHL
//
DBGET integrated database retrieval system