GenomeNet

Database: UniProt
Entry: Q8NDA2
LinkDB: Q8NDA2
Original site: Q8NDA2 
ID   HMCN2_HUMAN             Reviewed;        5059 AA.
AC   Q8NDA2; A0A096LP30; Q8N225; Q8TCI8;
DT   15-JUN-2010, integrated into UniProtKB/Swiss-Prot.
DT   13-APR-2016, sequence version 3.
DT   10-APR-2019, entry version 122.
DE   RecName: Full=Hemicentin-2 {ECO:0000305};
DE   Flags: Precursor;
GN   Name=HMCN2 {ECO:0000312|HGNC:HGNC:21293};
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15164053; DOI=10.1038/nature02465;
RA   Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
RA   Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
RA   Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
RA   Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
RA   Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
RA   Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
RA   Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
RA   Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
RA   Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
RA   Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
RA   Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
RA   Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
RA   Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
RA   Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
RA   Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
RA   Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
RA   Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
RA   Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
RA   McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
RA   Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
RA   Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
RA   Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
RA   Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
RA   Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
RA   Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
RA   Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
RA   Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
RA   Rogers J., Dunham I.;
RT   "DNA sequence and analysis of human chromosome 9.";
RL   Nature 429:369-374(2004).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3787-5059 (ISOFORM 2), AND
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4756-5059 (ISOFORM 1).
RC   TISSUE=Small intestine, and Thymus;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3096-5059 (ISOFORM 3).
RC   TISSUE=Testis;
RX   PubMed=17974005; DOI=10.1186/1471-2164-8-399;
RA   Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
RA   Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
RA   Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
RA   Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
RT   "The full-ORF clone resource of the German cDNA consortium.";
RL   BMC Genomics 8:399-399(2007).
CC   -!- SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular
CC       matrix {ECO:0000250|UniProtKB:A2AJ76}. Cleavage furrow
CC       {ECO:0000250|UniProtKB:A2AJ76}. Note=The antibody used to
CC       determine subcellular location does not distinguish between HMCN1
CC       and HMCN2. {ECO:0000250|UniProtKB:A2AJ76}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=3;
CC       Name=1;
CC         IsoId=Q8NDA2-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q8NDA2-2; Sequence=VSP_039367, VSP_039368;
CC         Note=No experimental confirmation available.;
CC       Name=3;
CC         IsoId=Q8NDA2-4; Sequence=VSP_058197, VSP_058198;
CC         Note=May be produced at very low levels due to a premature stop
CC         codon in the mRNA, leading to nonsense-mediated mRNA decay.
CC         {ECO:0000305};
CC   -!- SEQUENCE CAUTION:
CC       Sequence=BAB85069.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
CC       Sequence=BAC04201.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
CC       Sequence=CAD38854.1; Type=Erroneous translation; Note=Wrong choice of CDS.; Evidence={ECO:0000305};
CC       Sequence=EAW87931.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
DR   EMBL; ABBA01012042; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; ABBA01043973; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL354898; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL360004; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AUXG01000072; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; FP565345; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; KF458942; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471090; EAW87931.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; AK074396; BAB85069.1; ALT_INIT; mRNA.
DR   EMBL; AK093583; BAC04201.1; ALT_INIT; mRNA.
DR   EMBL; AL834139; CAD38854.1; ALT_SEQ; mRNA.
DR   UniGene; Hs.32194; -.
DR   UniGene; Hs.512559; -.
DR   ProteinModelPortal; Q8NDA2; -.
DR   SMR; Q8NDA2; -.
DR   STRING; 9606.ENSP00000485357; -.
DR   iPTMnet; Q8NDA2; -.
DR   PhosphoSitePlus; Q8NDA2; -.
DR   SwissPalm; Q8NDA2; -.
DR   BioMuta; HMCN2; -.
DR   DMDM; 298351848; -.
DR   EPD; Q8NDA2; -.
DR   jPOST; Q8NDA2; -.
DR   PaxDb; Q8NDA2; -.
DR   PeptideAtlas; Q8NDA2; -.
DR   PRIDE; Q8NDA2; -.
DR   ProteomicsDB; 72996; -.
DR   ProteomicsDB; 72997; -. [Q8NDA2-2]
DR   Ensembl; ENST00000624552; ENSP00000485357; ENSG00000148357. [Q8NDA2-1]
DR   UCSC; uc064wnb.1; human.
DR   DisGeNET; 256158; -.
DR   EuPathDB; HostDB:ENSG00000148357.16; -.
DR   GeneCards; HMCN2; -.
DR   H-InvDB; HIX0008467; -.
DR   HGNC; HGNC:21293; HMCN2.
DR   HPA; HPA053903; -.
DR   HPA; HPA070647; -.
DR   neXtProt; NX_Q8NDA2; -.
DR   OpenTargets; ENSG00000148357; -.
DR   PharmGKB; PA142671680; -.
DR   GeneTree; ENSGT00940000162328; -.
DR   HOGENOM; HOG000172035; -.
DR   HOVERGEN; HBG073398; -.
DR   InParanoid; Q8NDA2; -.
DR   ChiTaRS; HMCN2; human.
DR   PRO; PR:Q8NDA2; -.
DR   Proteomes; UP000005640; Chromosome 9.
DR   Bgee; ENSG00000148357; Expressed in 138 organ(s), highest expression level in islet of Langerhans.
DR   ExpressionAtlas; Q8NDA2; baseline and differential.
DR   GO; GO:0005604; C:basement membrane; IEA:Ensembl.
DR   GO; GO:0005938; C:cell cortex; IEA:Ensembl.
DR   GO; GO:0030054; C:cell junction; IEA:Ensembl.
DR   GO; GO:0032154; C:cleavage furrow; IEA:UniProtKB-SubCell.
DR   GO; GO:0062023; C:collagen-containing extracellular matrix; HDA:BHF-UCL.
DR   GO; GO:0031012; C:extracellular matrix; IBA:GO_Central.
DR   GO; GO:0005615; C:extracellular space; IBA:GO_Central.
DR   GO; GO:0005509; F:calcium ion binding; IEA:InterPro.
DR   GO; GO:0005201; F:extracellular matrix structural constituent; HDA:BHF-UCL.
DR   GO; GO:0050896; P:response to stimulus; IEA:UniProtKB-KW.
DR   Gene3D; 2.60.40.10; -; 43.
DR   Gene3D; 3.40.50.410; -; 1.
DR   InterPro; IPR026823; cEGF.
DR   InterPro; IPR001881; EGF-like_Ca-bd_dom.
DR   InterPro; IPR013032; EGF-like_CS.
DR   InterPro; IPR000742; EGF-like_dom.
DR   InterPro; IPR000152; EGF-type_Asp/Asn_hydroxyl_site.
DR   InterPro; IPR018097; EGF_Ca-bd_CS.
DR   InterPro; IPR006605; G2_nidogen/fibulin_G2F.
DR   InterPro; IPR009017; GFP.
DR   InterPro; IPR009030; Growth_fac_rcpt_cys_sf.
DR   InterPro; IPR032984; Hemicentin-2.
DR   InterPro; IPR007110; Ig-like_dom.
DR   InterPro; IPR036179; Ig-like_dom_sf.
DR   InterPro; IPR013783; Ig-like_fold.
DR   InterPro; IPR013098; Ig_I-set.
DR   InterPro; IPR003599; Ig_sub.
DR   InterPro; IPR003598; Ig_sub2.
DR   InterPro; IPR013106; Ig_V-set.
DR   InterPro; IPR036465; vWFA_dom_sf.
DR   PANTHER; PTHR44338:SF1; PTHR44338:SF1; 1.
DR   Pfam; PF12662; cEGF; 1.
DR   Pfam; PF07645; EGF_CA; 4.
DR   Pfam; PF07474; G2F; 1.
DR   Pfam; PF07679; I-set; 31.
DR   SMART; SM00181; EGF; 6.
DR   SMART; SM00179; EGF_CA; 6.
DR   SMART; SM00682; G2F; 1.
DR   SMART; SM00409; IG; 43.
DR   SMART; SM00408; IGc2; 43.
DR   SMART; SM00406; IGv; 14.
DR   SUPFAM; SSF48726; SSF48726; 43.
DR   SUPFAM; SSF53300; SSF53300; 1.
DR   SUPFAM; SSF54511; SSF54511; 1.
DR   SUPFAM; SSF57184; SSF57184; 2.
DR   PROSITE; PS00010; ASX_HYDROXYL; 3.
DR   PROSITE; PS01186; EGF_2; 3.
DR   PROSITE; PS50026; EGF_3; 5.
DR   PROSITE; PS01187; EGF_CA; 5.
DR   PROSITE; PS50835; IG_LIKE; 42.
DR   PROSITE; PS50993; NIDOGEN_G2; 1.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Calcium; Complete proteome; Disulfide bond;
KW   EGF-like domain; Extracellular matrix; Glycoprotein;
KW   Immunoglobulin domain; Methylation; Reference proteome; Repeat;
KW   Secreted; Sensory transduction; Signal.
FT   SIGNAL        1     22       {ECO:0000255}.
FT   CHAIN        23   5059       Hemicentin-2.
FT                                /FTId=PRO_0000395108.
FT   DOMAIN       38    205       VWFA.
FT   DOMAIN      517    602       Ig-like C2-type 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN      607    690       Ig-like C2-type 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN      697    780       Ig-like C2-type 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN      785    879       Ig-like C2-type 4. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN      884    970       Ig-like C2-type 5. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN      975   1061       Ig-like C2-type 6. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1066   1159       Ig-like C2-type 7. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1164   1244       Ig-like C2-type 8. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1265   1338       Ig-like C2-type 9. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1343   1429       Ig-like C2-type 10. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1436   1525       Ig-like C2-type 11. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1530   1618       Ig-like C2-type 12. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1623   1714       Ig-like C2-type 13. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1717   1805       Ig-like C2-type 14. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1810   1887       Ig-like C2-type 15. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1894   1982       Ig-like C2-type 16. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     1985   2074       Ig-like C2-type 17. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2079   2165       Ig-like C2-type 18. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2170   2261       Ig-like C2-type 19. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2264   2353       Ig-like C2-type 20. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2358   2447       Ig-like C2-type 21. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2452   2540       Ig-like C2-type 22. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2545   2636       Ig-like C2-type 23. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2641   2732       Ig-like C2-type 24. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2739   2833       Ig-like C2-type 25. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2849   2938       Ig-like C2-type 26. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     2945   3032       Ig-like C2-type 27. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3037   3127       Ig-like C2-type 28. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3131   3219       Ig-like C2-type 29. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3224   3314       Ig-like C2-type 30. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3319   3406       Ig-like C2-type 31. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3412   3497       Ig-like C2-type 32. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3502   3588       Ig-like C2-type 33. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3593   3681       Ig-like C2-type 34. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3686   3772       Ig-like C2-type 35. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3777   3848       Ig-like C2-type 36. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3851   3937       Ig-like C2-type 37. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     3942   4027       Ig-like C2-type 38. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     4031   4118       Ig-like C2-type 39. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     4123   4204       Ig-like C2-type 40. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     4212   4295       Ig-like C2-type 41. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     4303   4388       Ig-like C2-type 42. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00114}.
FT   DOMAIN     4392   4614       Nidogen G2 beta-barrel.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00348}.
FT   DOMAIN     4628   4668       EGF-like 1; calcium-binding.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DOMAIN     4669   4712       EGF-like 2; calcium-binding.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DOMAIN     4713   4751       EGF-like 3; calcium-binding.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DOMAIN     4756   4796       EGF-like 4; calcium-binding.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DOMAIN     4863   4902       EGF-like 5; calcium-binding.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   MOD_RES     911    911       Omega-N-methylarginine.
FT                                {ECO:0000250|UniProtKB:A2AJ76}.
FT   MOD_RES     916    916       Omega-N-methylarginine.
FT                                {ECO:0000250|UniProtKB:A2AJ76}.
FT   CARBOHYD    328    328       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD    345    345       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD    378    378       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD    477    477       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD    524    524       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD    546    546       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD    673    673       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   1023   1023       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   1071   1071       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   1267   1267       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   1353   1353       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   1536   1536       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   1562   1562       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   1670   1670       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   1819   1819       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   1908   1908       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2008   2008       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2087   2087       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2093   2093       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2251   2251       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2289   2289       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2369   2369       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2443   2443       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2476   2476       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2515   2515       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2580   2580       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2662   2662       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2866   2866       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   2960   2960       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   3404   3404       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   3534   3534       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   3549   3549       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   3696   3696       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   3700   3700       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   4062   4062       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   4264   4264       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   4415   4415       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   4561   4561       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   4804   4804       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   CARBOHYD   4994   4994       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00498}.
FT   DISULFID    537    586       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID    628    676       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID    718    764       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID    806    861       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID    905    954       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID    996   1045       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1094   1143       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1185   1228       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1272   1322       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1366   1415       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1459   1509       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1553   1602       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1647   1696       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1740   1789       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1832   1873       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   1915   1964       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2007   2058       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2100   2149       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2192   2243       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2288   2337       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2382   2431       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2475   2524       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2571   2620       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2669   2718       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2780   2829       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2875   2924       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   2967   3016       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3062   3111       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3154   3203       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3247   3298       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3343   3392       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3436   3481       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3525   3572       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3616   3665       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3707   3756       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3779   3830       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3872   3921       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   3963   4011       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   4053   4102       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   4144   4191       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   4234   4282       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   4324   4372       {ECO:0000255|PROSITE-ProRule:PRU00114}.
FT   DISULFID   4632   4643       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4639   4652       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4654   4667       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4673   4686       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4680   4695       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4699   4711       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4717   4730       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4724   4739       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4760   4771       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4767   4780       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4782   4795       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4867   4877       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4873   4886       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   DISULFID   4888   4901       {ECO:0000255|PROSITE-ProRule:PRU00076}.
FT   VAR_SEQ    3409   3446       VQVPPVLEPVEFQNDVVVVRGSLVELPCEARGVPLPLV ->
FT                                CPLSWSRWSSRMTWWWFVAPWWNSRARPGAFPCLSCRG
FT                                (in isoform 3). {ECO:0000305}.
FT                                /FTId=VSP_058197.
FT   VAR_SEQ    3447   5059       Missing (in isoform 3). {ECO:0000305}.
FT                                /FTId=VSP_058198.
FT   VAR_SEQ    4165   4192       EGVSEQDGGSTLQRAAVSREDSGTYVCW -> GLGLLGMGG
FT                                TESQDTGRLRREGRWGDPT (in isoform 2).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_039367.
FT   VAR_SEQ    4193   5059       Missing (in isoform 2).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_039368.
FT   CONFLICT   3289   3289       R -> W (in Ref. 4; CAD38854).
FT                                {ECO:0000305}.
SQ   SEQUENCE   5059 AA;  541978 MW;  5933D04A2F9AF3D7 CRC64;
     MPGAPLLRLL TAVSAAVAVA VAGAPGTVMP PTTGDATLAF VFDVTGSMWD ELMQVIDGAS
     RILERSLSRR SQAIANYALV PFHDPDIGPV TLTADPTVFQ RELRELYVQG GGDCPEMSVG
     AIKAAVEVAN PGSFIYVFSD ARAKDYHKKE ELLRLLQLKQ SQVVFVLTGD CGDRTHPGYL
     AYEEIAATSS GQVFHLDKQQ VTEVLKWVES AIQASKVHLL STDHEEEGEH TWRLPFDPSL
     KEVTISLSGP GPEIEVQDPL GRILQEDEGL NVLLNIPDSA KVVAFKPEHP GLWSIKVYSS
     GRHSVRITGV SNIDFRAGFS TQPLLDLNHT LEWPLQGVPI SLVINSTGLK APGRLDSVEL
     AQSSGKPLLT LPTKPLSNGS THQLWGGPPF HTPKERFYLK VKGKDHEGNP LLRVSGVSYS
     GVAPGAPLVS MAPRIHGYLH QPLLVSCSVH SALPFRLQLR RGEARLGEER HFQESGNSSW
     EILRASKAEE GTYECTAVSR AGTGRAKAQI VVTDPPPQLV PAPNVTVSPG ETAVLSCRVL
     GEAPYNLTWV RDWRVLPAST GRVAQLADLS LEISGIIPTD GGRYQCVASN ANGVTRASVW
     LLVREAPQVS IHTSSQHFSQ GVEVKVSCSA SGYPTPHISW SRESQALQED SRIHVDAQGT
     LIIQGVAPED AGNYSCQATN EVGTDQETVT LYYTDPPSVS AVNAVVLVAV GEEAVLVCEA
     SGVPPPRVIW YRGGLEMILA PEGSSSGKLR IPAAQERDAG TYTCRAVNEL GDASAEIQLA
     VGHAPQLTEL PRDVTVELGR SALLACRATG RPPPTVTWRR GDGQPLGLRL GAGRGSRSRQ
     PDSGVLFFES VAPEDQAPYV CEARNVFGKV QAEARLIVTG HAPPQIASSA PTVRVLEGQP
     VSLPCIVLAG RPLPERHWLK DGRPLPPGSR HSIRADGSLH LDRALQEHAG RYSCVATNTA
     GSQHRDVELV VQVPPRIHPT ATHHITNEGV AASLPCVASG VPAPTITWTK ETNALTSRGP
     HYNVSKEGTL LIAQPSAQDA GAYVCTATNT VGFSSQEMRL SVNTKPRIHM NGSRNADVPL
     QVTAKAGEEV TLDCEAKGSP PPLVTWTKDS RPVPPITNRY GLLPSGSLRL AQVQVGDSGH
     YECTASNPAG SASHRYVLGV QVPPQVQPGP RVLKVLVGEA LDLNCVAEGN PEPQLSWSKD
     GVVLQGRGPQ GSVHFAAIRT SDAGRYRCEA SNSAGVDAWE VELRVLEPPH WGADETSGLL
     ERVAGENASL PCPARGTPKP QVTWRKGPSS EPLHGQPGVA VLEEGSLFLA SVSPADSGDY
     ECQATNEVGS TSRRAKLVVY VPPSIREDGR KANVSGMAGQ SLTLECDANG FPVPEIVWLK
     DAQLIPKVGG HRLLDEGQSL HFPRIQEGDS GLYSCRAENQ AGTAQRDFHL LVLTPPSVLG
     AGAAQEVLGL AGADVELQCW TSGVPTPQVE WTKDRQPVLP GGPHLQVQED GQVLRITGSH
     VGDEGRYQCV AFSPAGQQAR DFQLRVHAPP TIWGSNETGE VAVMEDHLVQ LLCEARGVPT
     PNITWFKDGA LLPTSTKVVY TRGGRQLQLG RAQSSDAGVY TCKASNAVGA AEKATRLDVY
     VPPTIEGAGG RPYVVKAVAG RPVALECVAR GHPSPTLSWH HEGLPVAESN ESRLETDGSV
     LRLESPGEAS SGLYSCVASS PAGEAVLQYS VEVQVPPQLL VAEGLGQVTT IVGQPLELPC
     QASGSPVPTI QWLQNGRPAE ELAGVQVASQ GTTLHIDHVE LDHSGLFACQ ATNEAGTAGA
     EVEVSVHEFP SVSIIGGENI TAPFLQPVTL QCIGDGVPTP SLRWWKDGVA LAAFGGNLQI
     EKVDLRDEGI YTCAATNLAG ESKREVALKV LVPPNIEPGP VNKAVLENAS VTLECLASGV
     PPPDVSWFKG HQPVSSWMGV TVSVDGRVLR IEQAQLSDAG SYRCVASNVA GSTELRYGLR
     VNVPPRITLP PSLPGPVLVN TPVRLTCNAT GAPSPTLMWL KDGNPVSPAG TPGLQVFPGG
     RVLTLASARA SDSGRYSCVA VSAVGEDRQD VVLQVHMPPS ILGEELNVSV VANESVALEC
     QSHAMPPPVL SWWKDGRPLE PRPGVHLSAD KALLQVDRAD VWDAGHYTCE ALNQAGHSEK
     HYNLNVWVAP VFPLRESHTL TVREGHPTRL SCECRGVPFP KISWRKDGQP LPGEGAGLQH
     VSAVGRLLYL GQAQLAQEGT YTCECSNVVG NSSQDLQLEV HVPPQIAGPR EPPTQVSVVQ
     DGVATLECNA TGKPPPTVTW ERDGQPVGAE LGLQLQNQGQ SLHVERAQAA HTGRYSCVAE
     NLAGRAERKF ELSVLVPPEL IGDLDPLTNI TAALHSPLTL LCEAMGIPPP AIRWFRGEEP
     VSPGEDTYLL AGGWMLKMTQ TQEQDSGLYS CLASNEAGEA RRNFSVEVLV PPSIENEDLE
     EVIKVLDGQT AHLMCNVTGH PQPKLTWFKD GRPLARGDAH HISPDGVLLQ VLQANLSSAG
     HYSCIAANAV GEKTKHFQLS VLLAPTILGG AEDSADEEVT VTVNNPISLI CEALAFPSPN
     ITWMKDGAPF EASRNIQLLP GTHGLQILNA QKEDAGQYTC VVTNELGEAV KNYHVEVLIP
     PSISKDDPLA EVGVKEVKTK VNSTLTLECE SWAVPPPTIR WYKDGQPVTP SSRLQVLGEG
     RLLQIQPTQV SDSGRYLCVA TNVAGEDDQD FNVLIQVPPM FQKVGDFSAA FEILSREEEA
     RGGVTEYREI VENNPAYLYC DTNAIPPPDL TWYREDQPLS AGDEVSVLQG GRVLQIPLVR
     AENAGRYSCK ASNEVGEDWL HYELLVLTPP VILGDTEELV EEVTVNASST VSLQCPALGN
     PVPTISWLQN GLPFSPSPRL QVLEDGQVLQ VSTAEVADAA SYMCVAENQA GSAEKLFTLR
     VQVPPRIAGL DLEQVTAILN SSVSLPCDVH AHPNPEVTWY KDSQALSLGE EVFLLPGTHT
     LQLGRARLSD SGMYTCEALN AAGRDQKLVQ LSVLVPPAFR QAPRGPQDAV LVRVGDKAVL
     SCETDALPEP TVTWYKDGQP LVLAQRTQAL RGGQRLEIQE AQVSDKGLYS CKVSNVAGEA
     VRTFTLTVQV PPTFENPKTE TVSQVAGSPL VLTCDVSGVP APTVTWLKDR MPVESSAVHG
     VVSRGGRLQL SRLQPAQAGT YTCVAENTQA EARKDFVVAV LVAPRIRSSG VAREHHVLEG
     QEVRLDCEAD GQPPPDVAWL KDGSPLGQDM GPHLRFYLDG GSLVLKGLRA SDAGAYTCVA
     HNPAGEDARL HTVNVLVPPT IKQGADGSGT LVSRPGELVT MVCPVRGSPP IHVSWLKDGL
     PLPLSQRTLL HGSGHTLRIS KVQLADAGIF TCVAASPAGV ADRNFTLQVQ VPPVLEPVEF
     QNDVVVVRGS LVELPCEARG VPLPLVSWMK DGEPLLSQSL EQGPSLQLEA VGAGDSGTYS
     CVAVSEAGEA RRHFQLTVME PPHIEDSGQP TELSLTPGAP MELLCDAQGT PQPNITWHKD
     GQALTRLENN SRATRVLRVE NVQVRDAGLY TCLAESPAGA IEKSFRVRVQ APPNIVGPRG
     PRFVVGLAPG QLVLECSVEA EPAPKITWHR DGIVLQEDAH TQFPERGRFL QLQALSTADS
     GDYSCTARNA AGSTSVAFRV EIHTVPTIRS GPPAVNVSVN QTALLPCQAD GVPAPLVSWR
     KDRVPLDPRS PRFEILPEGS LRIQPVLAQD AGHYLCLASN SAGSDRQGRD LRVLALLPCE
     ASGSPKPLVV WWKDGQKLDF RLQQGAYRLL PSNALLLTAP GPQDSAQFEC VVSNEVGEAH
     RLYQVTVHVP PTIADDQTDF TVTMMAPVVL TCHSTGIPAP TVSWSKAGAQ LGARGSGYRV
     SPSGALEIGQ ALPIHAGRYT CSARNSAGVA HKHVFLTVQA SPVVKPLPSV VRAVAEEEVL
     LPCEASGIPR PTITWQKEGL NVATGVSTQV LPGGQLRIAH ASPEDAGNYL CIAKNSAGSA
     MGKTRLVVQV PPVIENGLPD LSTTEGSHAF LPCKARGSPE PNITWDKDGQ PVSGAEGKFT
     IQPSGELLVK NLEGQDAGTY TCTAENAVGR ARRRVHLTIL VLPVFTTLPG DRSLRLGDRL
     WLRCAARGSP TPRIGWTVND RPVTEGVSEQ DGGSTLQRAA VSREDSGTYV CWAENRVGRT
     QAVSFVHVKE APVLQGEAFS YLVEPVGGSI QLDCVVRGDP VPDIHWIKDG LPLRGSHLRH
     QLQNGSLTIR RTERDDAGRY QCLAENEMGV AKKVVILVLQ SAPVFQVEPQ DMTVRSGDDV
     ALRCQATGEP TPTIEWLQAG QPLRASRRLR TLPDGSLWLE NVETGDAGTY DCVAHNLLGS
     ATARAFLVVR GEPQGSWGSM TGVINGRKFG VATLNTSVMQ EAHSGVSSIH SSIRHVPANV
     GPLMRVLVVT IAPIYWALAR ESGEALNGHS LTGGRFRQES HVEFATGELL TMTQVARGLD
     PDGLLLLDVV VNGVVPESLA DADLQVQDFE EHYVQTGPGQ LFVGSTQRFF QGGLPSFLRC
     NHSIQYNAAR GPQPQLVQHL RASAISSAFD PEAEALRFQL ATALQAEENE VGCPEGFELD
     SQGAFCVDRD ECSGGPSPCS HACLNAPGRF SCTCPTGFAL AWDDRNCRDV DECAWDAHLC
     REGQRCVNLL GSYRCLPDCG PGFRVADGAG CEDVDECLEG LDDCHYNQLC ENTPGGHRCS
     CPRGYRMQGP SLPCLDVNEC LQLPKACAYQ CHNLQGSYRC LCPPGQTLLR DGKACTSLER
     NGQNVTTVSH RGPLLPWLRP WASIPGTSYH AWVSLRPGPM ALSSVGRAWC PPGFIRQNGV
     CTDLDECRVR NLCQHACRNT EGSYQCLCPA GYRLLPSGKN CQDINECEEE SIECGPGQMC
     FNTRGSYQCV DTPCPATYRQ GPSPGTCFRR CSQDCGTGGP STLQYRLLPL PLGVRAHHDV
     ARLTAFSEVG VPANRTELSM LEPDPRSPFA LRPLRAGLGA VYTRRALTRA GLYRLTVRAA
     APRHQSVFVL LIAVSPYPY
//
DBGET integrated database retrieval system