GenomeNet

Database: UniProt
Entry: Q96NU0
LinkDB: Q96NU0
Original site: Q96NU0 
ID   CNT3B_HUMAN             Reviewed;        1288 AA.
AC   Q96NU0; A0A087WUH3; B1B0V7; B1B0V8; B1B0V9; B1B0W0; B1B0X8; B1B162;
AC   Q4VXF0; Q9H7W3;
DT   10-JUN-2008, integrated into UniProtKB/Swiss-Prot.
DT   28-MAR-2018, sequence version 3.
DT   10-APR-2019, entry version 137.
DE   RecName: Full=Contactin-associated protein-like 3B;
DE   AltName: Full=Cell recognition molecule Caspr3b;
DE   Flags: Precursor;
GN   Name=CNTNAP3B; Synonyms=CASPR3B;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RC   TISSUE=Glial tumor, and Teratocarcinoma;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15164053; DOI=10.1038/nature02465;
RA   Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
RA   Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
RA   Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
RA   Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
RA   Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
RA   Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
RA   Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
RA   Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
RA   Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
RA   Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
RA   Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
RA   Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
RA   Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
RA   Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
RA   Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
RA   Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
RA   Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
RA   Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
RA   McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
RA   Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
RA   Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
RA   Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
RA   Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
RA   Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
RA   Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
RA   Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
RA   Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
RA   Rogers J., Dunham I.;
RT   "DNA sequence and analysis of human chromosome 9.";
RL   Nature 429:369-374(2004).
RN   [3]
RP   GENE DUPLICATION.
RX   PubMed=15820314; DOI=10.1016/j.ygeno.2005.01.002;
RA   Boyadjiev S.A., South S.T., Radford C.L., Patel A., Zhang G.,
RA   Hur D.J., Thomas G.H., Gearhart J.P., Stetten G.;
RT   "A reciprocal translocation 46,XY,t(8;9)(p11.2;q13) in a bladder
RT   exstrophy patient disrupts CNTNAP3 and presents evidence of a
RT   pericentromeric duplication on chromosome 9.";
RL   Genomics 85:622-629(2005).
CC   -!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type I
CC       membrane protein {ECO:0000305}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=Q96NU0-1; Sequence=Displayed;
CC         Note=No experimental confirmation available. Gene prediction
CC         based on EST data. {ECO:0000305};
CC       Name=2;
CC         IsoId=Q96NU0-2; Sequence=VSP_034153, VSP_034154, VSP_034155,
CC                                  VSP_034156;
CC         Note=No experimental confirmation available. May be produced at
CC         very low levels due to a premature stop codon in the mRNA,
CC         leading to nonsense-mediated mRNA decay. {ECO:0000305};
CC   -!- MISCELLANEOUS: The gene encoding CNTNAP3B is the result of a
CC       pericentromeric duplication of the genomic region encoding CNTNAP3
CC       on chromosome 9.
CC   -!- SIMILARITY: Belongs to the neurexin family. {ECO:0000305}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=CAI16324.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
CC       Sequence=CAI16325.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
CC       Sequence=CAI95321.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
DR   EMBL; AK054645; BAB70782.1; -; mRNA.
DR   EMBL; AL953854; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BX664735; CAI16324.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; BX649569; CAI16324.1; JOINED; Genomic_DNA.
DR   EMBL; CR788268; CAI16324.1; JOINED; Genomic_DNA.
DR   EMBL; BX664735; CAI16325.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; BX649569; CAI16325.1; JOINED; Genomic_DNA.
DR   EMBL; CR788268; CAI16325.1; JOINED; Genomic_DNA.
DR   EMBL; BX664735; CAI16326.1; -; Genomic_DNA.
DR   EMBL; BX649569; CAI16326.1; JOINED; Genomic_DNA.
DR   EMBL; CR788268; CAI16326.1; JOINED; Genomic_DNA.
DR   EMBL; BX664735; CAI95321.1; ALT_SEQ; Genomic_DNA.
DR   EMBL; BX649569; CAI95321.1; JOINED; Genomic_DNA.
DR   EMBL; CR788268; CAI95321.1; JOINED; Genomic_DNA.
DR   CCDS; CCDS75836.1; -. [Q96NU0-1]
DR   RefSeq; NP_001188309.2; NM_001201380.2. [Q96NU0-1]
DR   UniGene; Hs.521495; -.
DR   UniGene; Hs.604441; -.
DR   UniGene; Hs.722375; -.
DR   ProteinModelPortal; Q96NU0; -.
DR   SMR; Q96NU0; -.
DR   STRING; 9606.ENSP00000478671; -.
DR   iPTMnet; Q96NU0; -.
DR   PhosphoSitePlus; Q96NU0; -.
DR   BioMuta; CNTNAP3B; -.
DR   DMDM; 190358858; -.
DR   jPOST; Q96NU0; -.
DR   PaxDb; Q96NU0; -.
DR   PeptideAtlas; Q96NU0; -.
DR   PRIDE; Q96NU0; -.
DR   ProteomicsDB; 77558; -.
DR   ProteomicsDB; 77559; -. [Q96NU0-2]
DR   TopDownProteomics; Q96NU0-2; -. [Q96NU0-2]
DR   Ensembl; ENST00000377561; ENSP00000478671; ENSG00000154529. [Q96NU0-1]
DR   GeneID; 728577; -.
DR   KEGG; hsa:728577; -.
DR   UCSC; uc064thx.1; human. [Q96NU0-1]
DR   CTD; 728577; -.
DR   EuPathDB; HostDB:ENSG00000154529.14; -.
DR   GeneCards; CNTNAP3B; -.
DR   H-InvDB; HIX0034795; -.
DR   H-InvDB; HIX0035297; -.
DR   HGNC; HGNC:32035; CNTNAP3B.
DR   HPA; HPA047731; -.
DR   neXtProt; NX_Q96NU0; -.
DR   OpenTargets; ENSG00000154529; -.
DR   eggNOG; KOG3516; Eukaryota.
DR   eggNOG; ENOG410XPHG; LUCA.
DR   GeneTree; ENSGT00940000160228; -.
DR   HOVERGEN; HBG057718; -.
DR   InParanoid; Q96NU0; -.
DR   OMA; IQAERNV; -.
DR   OrthoDB; 338397at2759; -.
DR   PhylomeDB; Q96NU0; -.
DR   TreeFam; TF321823; -.
DR   ChiTaRS; CNTNAP3B; human.
DR   GenomeRNAi; 728577; -.
DR   PRO; PR:Q96NU0; -.
DR   Proteomes; UP000005640; Chromosome 9.
DR   Bgee; ENSG00000154529; Expressed in 91 organ(s), highest expression level in lower esophagus.
DR   ExpressionAtlas; Q96NU0; baseline and differential.
DR   Genevisible; Q96NU0; HS.
DR   GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR   GO; GO:0007155; P:cell adhesion; IEA:UniProtKB-KW.
DR   CDD; cd00057; FA58C; 1.
DR   Gene3D; 2.60.120.260; -; 1.
DR   InterPro; IPR028873; CASPR3.
DR   InterPro; IPR013320; ConA-like_dom_sf.
DR   InterPro; IPR000742; EGF-like_dom.
DR   InterPro; IPR000421; FA58C.
DR   InterPro; IPR036056; Fibrinogen-like_C.
DR   InterPro; IPR002181; Fibrinogen_a/b/g_C_dom.
DR   InterPro; IPR008979; Galactose-bd-like_sf.
DR   InterPro; IPR001791; Laminin_G.
DR   PANTHER; PTHR43925:SF6; PTHR43925:SF6; 1.
DR   Pfam; PF00754; F5_F8_type_C; 1.
DR   Pfam; PF02210; Laminin_G_2; 4.
DR   SMART; SM00181; EGF; 2.
DR   SMART; SM00231; FA58C; 1.
DR   SMART; SM00282; LamG; 4.
DR   SUPFAM; SSF49785; SSF49785; 1.
DR   SUPFAM; SSF49899; SSF49899; 4.
DR   SUPFAM; SSF56496; SSF56496; 1.
DR   PROSITE; PS50026; EGF_3; 2.
DR   PROSITE; PS01285; FA58C_1; 1.
DR   PROSITE; PS01286; FA58C_2; 1.
DR   PROSITE; PS50022; FA58C_3; 1.
DR   PROSITE; PS51406; FIBRINOGEN_C_2; 1.
DR   PROSITE; PS50025; LAM_G_DOMAIN; 4.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Cell adhesion; Complete proteome;
KW   Disulfide bond; EGF-like domain; Glycoprotein; Membrane;
KW   Reference proteome; Repeat; Signal; Transmembrane;
KW   Transmembrane helix.
FT   SIGNAL        1     25       {ECO:0000255}.
FT   CHAIN        26   1288       Contactin-associated protein-like 3B.
FT                                /FTId=PRO_0000339353.
FT   TOPO_DOM     26   1245       Extracellular. {ECO:0000255}.
FT   TRANSMEM   1246   1266       Helical. {ECO:0000255}.
FT   TOPO_DOM   1267   1288       Cytoplasmic. {ECO:0000255}.
FT   DOMAIN       31    177       F5/8 type C. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00081}.
FT   DOMAIN      183    364       Laminin G-like 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00122}.
FT   DOMAIN      370    545       Laminin G-like 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00122}.
FT   DOMAIN      547    584       EGF-like 1. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00076}.
FT   DOMAIN      585    792       Fibrinogen C-terminal.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00739}.
FT   DOMAIN      793    958       Laminin G-like 3. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00122}.
FT   DOMAIN      959    997       EGF-like 2. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00076}.
FT   DOMAIN     1016   1203       Laminin G-like 4. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00122}.
FT   CARBOHYD    359    359       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    706    706       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   DISULFID     31    177       {ECO:0000250}.
FT   DISULFID    332    364       {ECO:0000250}.
FT   DISULFID    513    545       {ECO:0000250}.
FT   DISULFID    551    562       {ECO:0000250}.
FT   DISULFID    556    571       {ECO:0000250}.
FT   DISULFID    573    583       {ECO:0000250}.
FT   DISULFID    931    958       {ECO:0000250}.
FT   DISULFID    962    975       {ECO:0000250}.
FT   DISULFID    969    984       {ECO:0000250}.
FT   DISULFID    986    996       {ECO:0000250}.
FT   DISULFID   1167   1203       {ECO:0000250}.
FT   VAR_SEQ     493    586       GCLGNSSGSGCKSPLGGFQGCLRLITIGDKAVDPILVQQGA
FT                                LGSFRDLQIDSCGITDRCLPSYCEHGGECSQSWDTFSCDCL
FT                                GTGYTGETCHSS -> A (in isoform 2).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_034153.
FT   VAR_SEQ     626    626       Missing (in isoform 2).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_034154.
FT   VAR_SEQ     694    698       DGTPL -> GLVTQ (in isoform 2).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_034155.
FT   VAR_SEQ     699   1288       Missing (in isoform 2).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_034156.
FT   CONFLICT     33     33       S -> A (in Ref. 1; BAB70782).
FT                                {ECO:0000305}.
FT   CONFLICT    316    317       LS -> PT (in Ref. 1; BAB70782).
FT                                {ECO:0000305}.
FT   CONFLICT    414    414       R -> S (in Ref. 1; BAB70782).
FT                                {ECO:0000305}.
FT   CONFLICT    420    420       V -> I (in Ref. 1; BAB70782).
FT                                {ECO:0000305}.
FT   CONFLICT    439    439       P -> L (in Ref. 1; BAB70782).
FT                                {ECO:0000305}.
FT   CONFLICT    652    652       L -> R (in Ref. 1; BAB70782).
FT                                {ECO:0000305}.
FT   CONFLICT   1032   1032       H -> Y (in Ref. 2; CAI16324/CAI16326).
FT                                {ECO:0000305}.
FT   CONFLICT   1051   1051       T -> S (in Ref. 2; CAI16324/CAI16326).
FT                                {ECO:0000305}.
FT   CONFLICT   1175   1175       C -> R (in Ref. 2; CAI16326).
FT                                {ECO:0000305}.
FT   CONFLICT   1247   1247       I -> M (in Ref. 2; CAI16326).
FT                                {ECO:0000305}.
FT   CONFLICT   1254   1254       E -> V (in Ref. 2; CAI16326).
FT                                {ECO:0000305}.
SQ   SEQUENCE   1288 AA;  140415 MW;  11852910E1338C58 CRC64;
     MASVAWAVLK VLLLLPTQTW SPVGAGNPPD CDSPLASALP RSSFSSSSEL SSSHGPGFSR
     LNRRDGAGGW TPLVSNKYQW LQIDLGERME VTAVATQGGY GSSDWVTSYL LMFSDGGRNW
     KQYRREESIW GFPGNTNADS VVHYRLQPPF EARFLRFLPL AWNPRGRIGM RIEVYGCAYK
     SEVVYFDGQS ALLYTLDKKP LKPIRDVISL KFKAMQSNGI LLHREGQHGN HITLELIKGK
     LVFFLNSGNA KLPSTIAPVT LTLGSLLDDQ HWHSVLIELL DTQVNFTVDK HTHHFQAKGD
     SSNLDLNFEI SFGGILSPGR SRAFTRKSFH GCLENLYYNG VDVTELAKKH KPQILMMGNV
     SFSCPQPQTV PVTFLSSRSY LALPGNSGED KVSVTFQFRT WNRAGHLLFG ELQRGSGSFV
     LFLKDGKLKL SLFQAGQSPR NVTAGAGLND GQWHSVSFSA KWSHMNVVVD DDTAVQPLVA
     VLIDSGDTYY FGGCLGNSSG SGCKSPLGGF QGCLRLITIG DKAVDPILVQ QGALGSFRDL
     QIDSCGITDR CLPSYCEHGG ECSQSWDTFS CDCLGTGYTG ETCHSSLYEQ SCEAHKHRGN
     PSGLYYIDAD GSGPLGPFLV YCNMTADSAW TVVRHGGPDA VTLRGAPSGH PLSAVSFAYA
     AGAGQLRAAV NLAERCEQRL ALRCGTARRP DSRDGTPLSW WVGRTNETHT SWGGSLPDAQ
     KCTCGLEGNC IDSQYYCNCD AGQNEWTSDT IVLSQKEHLP VTQIVMTDTG QPHSEADYTL
     GPLLCRGDKS FWNSASFNTE TSYLHFPAFH GELTADVCFF FKTTVSSGVF MENLGITDFI
     RIELRAPTEV TFSFDVGNGP CEVTVQSPTP FNDNQWHHVR AERNVKGASL QVDQLPQKMQ
     PAPADGHVRL QLNSQLFIGG TATRQRGFLG CIRSLQLNGV ALDLEERATV TPGVEPGCAG
     HCSTYGHLCR NGGRCREKRR GVTCDCAFSA YDGPFCSNEI SAYFATGSSM TYHFQEHYTL
     SENSSSLVSS LHRDVTLTRE MITLSFRTTR TPSLLLYVSS FYEEYLSVIL ANNGSLQIRY
     KLDRHQNPDA FTFDFKNMAD GQLHQVKINR EEAVVMVEVN QSAKKQVILS SGTEFNAVKS
     LILGKVLEAA GADPDTRRAA TSGFTGCLSA VRFGCAAPLK AALRPSGPSR VTVRGHVAPM
     ARCAAGAASG SPARELAPRL AGGAGRSGPV DEGEPLVNAD RRDSAVIGGV IAVEIFILLC
     ITAIAIRIYQ QRKLRKENES KVSKKEEC
//
DBGET integrated database retrieval system