GenomeNet

Database: UniProt
Entry: Q9MZK9
LinkDB: Q9MZK9
Original site: Q9MZK9 
ID   KLRD1_MACMU             Reviewed;         179 AA.
AC   Q9MZK9; Q9GK91; Q9MZK7; Q9MZK8;
DT   15-MAY-2002, integrated into UniProtKB/Swiss-Prot.
DT   01-OCT-2000, sequence version 1.
DT   10-APR-2019, entry version 109.
DE   RecName: Full=Natural killer cells antigen CD94;
DE   AltName: Full=Killer cell lectin-like receptor subfamily D member 1;
DE   AltName: Full=NK cell receptor;
DE   AltName: CD_antigen=CD94;
GN   Name=KLRD1; Synonyms=CD94;
OS   Macaca mulatta (Rhesus macaque).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
OX   NCBI_TaxID=9544;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
RX   PubMed=10866118; DOI=10.1007/s002510050650;
RA   LaBonte M.L., Levy D.B., Letvin N.L.;
RT   "Characterization of rhesus monkey CD94/NKG2 family members and
RT   identification of novel transmembrane-deleted forms of NKG2-A, B, C,
RT   and D.";
RL   Immunogenetics 51:496-499(2000).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
RX   PubMed=11261935; DOI=10.1007/s002510000289;
RA   Kravitz R.H., Grendell R.L., Slukvin I.I., Golos T.G.;
RT   "Selective expression of NKG2-A and NKG2-C mRNAs and novel alternative
RT   splicing of 5' exons in rhesus monkey decidua.";
RL   Immunogenetics 53:69-73(2001).
CC   -!- FUNCTION: Plays a role as a receptor for the recognition of MHC
CC       class I HLA-E molecules by NK cells and some cytotoxic T-cells.
CC       {ECO:0000250|UniProtKB:Q13241}.
CC   -!- SUBUNIT: Can form disulfide-bonded heterodimer with NKG2 family
CC       members (By similarity). Interacts with the adapter protein
CC       TYROBP/DAP12; the interaction leads to natural killer cell
CC       activation (By similarity). {ECO:0000250|UniProtKB:Q13241}.
CC   -!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Single-pass
CC       type II membrane protein {ECO:0000255}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=3;
CC       Name=1; Synonyms=CD94-A;
CC         IsoId=Q9MZK9-1; Sequence=Displayed;
CC       Name=2; Synonyms=CD94-B;
CC         IsoId=Q9MZK9-2; Sequence=VSP_003055;
CC       Name=3; Synonyms=CD94 alt;
CC         IsoId=Q9MZK9-3; Sequence=VSP_003054;
CC   -!- TISSUE SPECIFICITY: Natural killer cells.
DR   EMBL; AF190931; AAF74527.1; -; mRNA.
DR   EMBL; AF190932; AAF74528.1; -; mRNA.
DR   EMBL; AF190933; AAF74529.1; -; mRNA.
DR   EMBL; AF294886; AAG34498.1; -; mRNA.
DR   RefSeq; NP_001028000.1; NM_001032828.1.
DR   RefSeq; XP_015006475.1; XM_015150989.1.
DR   UniGene; Mmu.1748; -.
DR   ProteinModelPortal; Q9MZK9; -.
DR   SMR; Q9MZK9; -.
DR   STRING; 9544.ENSMMUP00000024061; -.
DR   GeneID; 574145; -.
DR   KEGG; mcc:574145; -.
DR   CTD; 3824; -.
DR   eggNOG; KOG4297; Eukaryota.
DR   eggNOG; ENOG410XPJ1; LUCA.
DR   HOGENOM; HOG000220925; -.
DR   HOVERGEN; HBG099800; -.
DR   InParanoid; Q9MZK9; -.
DR   KO; K06516; -.
DR   Proteomes; UP000006718; Unplaced.
DR   GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR   GO; GO:0030246; F:carbohydrate binding; IEA:UniProtKB-KW.
DR   CDD; cd03593; CLECT_NK_receptors_like; 1.
DR   Gene3D; 3.10.100.10; -; 1.
DR   InterPro; IPR001304; C-type_lectin-like.
DR   InterPro; IPR016186; C-type_lectin-like/link_sf.
DR   InterPro; IPR016187; CTDL_fold.
DR   InterPro; IPR033992; NKR-like_CTLD.
DR   Pfam; PF00059; Lectin_C; 1.
DR   SMART; SM00034; CLECT; 1.
DR   SUPFAM; SSF56436; SSF56436; 1.
DR   PROSITE; PS50041; C_TYPE_LECTIN_2; 1.
PE   2: Evidence at transcript level;
KW   Alternative splicing; Cell membrane; Complete proteome;
KW   Disulfide bond; Glycoprotein; Lectin; Membrane; Polymorphism;
KW   Receptor; Reference proteome; Signal-anchor; Transmembrane;
KW   Transmembrane helix.
FT   CHAIN         1    179       Natural killer cells antigen CD94.
FT                                /FTId=PRO_0000046588.
FT   TOPO_DOM      1     10       Cytoplasmic. {ECO:0000255}.
FT   TRANSMEM     11     31       Helical; Signal-anchor for type II
FT                                membrane protein. {ECO:0000255}.
FT   TOPO_DOM     32    179       Extracellular. {ECO:0000255}.
FT   DOMAIN       68    175       C-type lectin. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00040}.
FT   CARBOHYD     83     83       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   CARBOHYD    132    132       N-linked (GlcNAc...) asparagine.
FT                                {ECO:0000255}.
FT   DISULFID     58     70       {ECO:0000255|PROSITE-ProRule:PRU00040}.
FT   DISULFID     59     59       Interchain (with C-116 in NGK2A).
FT                                {ECO:0000255|PROSITE-ProRule:PRU00040}.
FT   DISULFID     61     72       {ECO:0000255|PROSITE-ProRule:PRU00040}.
FT   DISULFID     89    174       {ECO:0000255|PROSITE-ProRule:PRU00040}.
FT   DISULFID    152    166       {ECO:0000255|PROSITE-ProRule:PRU00040}.
FT   VAR_SEQ       1     34       MAVFKTTLWRLISGTLGIICLSLMATLGILLKNS -> MAA
FT                                (in isoform 3).
FT                                {ECO:0000303|PubMed:10866118}.
FT                                /FTId=VSP_003054.
FT   VAR_SEQ     105    105       L -> LQ (in isoform 2).
FT                                {ECO:0000303|PubMed:10866118}.
FT                                /FTId=VSP_003055.
FT   VARIANT     139    139       Y -> D.
SQ   SEQUENCE   179 AA;  20607 MW;  06212B4494527F07 CRC64;
     MAVFKTTLWR LISGTLGIIC LSLMATLGIL LKNSFTKLSV EPAYTPGPNI ELQKDSDCCS
     CHEKWVGYRC NCYFISSEEK TWNESRHFCA SQKSSLLQLQ NRDELDFMSS SQHFYWIGLS
     YSEEHTAWLW ENGSALSQYL FPSFETFKPK NCIAYNSKGN ALDESCETKN RYICKQQLI
//
DBGET integrated database retrieval system