GenomeNet

Database: UniProt
Entry: Q9NQ79
LinkDB: Q9NQ79
Original site: Q9NQ79 
ID   CRAC1_HUMAN             Reviewed;         661 AA.
AC   Q9NQ79; B1ALN4; Q5T4F8; Q8N4H6; Q8TE52; Q9NQ78; Q9NQ80; Q9NW46;
DT   19-JUL-2004, integrated into UniProtKB/Swiss-Prot.
DT   19-JUL-2004, sequence version 2.
DT   13-FEB-2019, entry version 140.
DE   RecName: Full=Cartilage acidic protein 1;
DE   AltName: Full=68 kDa chondrocyte-expressed protein;
DE            Short=CEP-68;
DE   AltName: Full=ASPIC;
DE   Flags: Precursor;
GN   Name=CRTAC1; Synonyms=ASPIC1, CEP68;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
RC   TISSUE=Cartilage;
RA   Bolton M.C., Wait R., Saklatvala J.;
RT   "Cloning of ASPIC, a novel protein secreted by human normal and
RT   osteoarthritic cartilage, identified by 2D electrophoresis and mass
RT   spectrometry.";
RL   Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases.
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND NUCLEOTIDE
RP   SEQUENCE [LARGE SCALE MRNA] OF 105-661 (ISOFORM 3).
RC   TISSUE=Synovium;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=15164054; DOI=10.1038/nature02462;
RA   Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L.,
RA   Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K.,
RA   Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L.,
RA   Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P.,
RA   Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J.,
RA   Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J.,
RA   Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D.,
RA   Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
RA   Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L.,
RA   Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S.,
RA   Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L.,
RA   Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J.,
RA   Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M.,
RA   Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S.,
RA   Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M.,
RA   Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A.,
RA   Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T.,
RA   Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I.,
RA   Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T.,
RA   Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M.,
RA   Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W.,
RA   Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H.,
RA   Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L.,
RA   Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K.,
RA   Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T.,
RA   Doucette-Stamm L., Beck S., Smith D.R., Rogers J.;
RT   "The DNA sequence and comparative analysis of human chromosome 10.";
RL   Nature 429:375-381(2004).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [MRNA] OF 9-661 (ISOFORMS 1 AND 2), INDUCTION, AND
RP   TISSUE SPECIFICITY.
RC   TISSUE=Brain, and Cartilage;
RX   PubMed=11139377; DOI=10.1042/0264-6021:3530169;
RA   Steck E., Benz K., Lorenz H., Loew M., Gress T., Richter W.;
RT   "Chondrocyte expressed protein-68 (CEP-68), a novel human marker gene
RT   for cultured chondrocytes.";
RL   Biochem. J. 353:169-174(2001).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 129-661 (ISOFORM 1).
RC   TISSUE=Brain;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [6]
RP   NUCLEOTIDE SEQUENCE [MRNA] OF 608-661 (ISOFORM 1), PARTIAL NUCLEOTIDE
RP   SEQUENCE [MRNA] (ISOFORM 2), EXON SHARING WITH GOLGA7B (ISOFORM 1),
RP   GLYCOSYLATION, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
RX   PubMed=17074475; DOI=10.1016/j.matbio.2006.09.006;
RA   Steck E., Braeun J., Pelttari K., Kadel S., Kalbacher H., Richter W.;
RT   "Chondrocyte secreted CRTAC1: a glycosylated extracellular matrix
RT   molecule of human articular cartilage.";
RL   Matrix Biol. 26:30-41(2007).
CC   -!- INTERACTION:
CC       P29972:AQP1; NbExp=3; IntAct=EBI-10205543, EBI-745213;
CC       Q15555:MAPRE2; NbExp=5; IntAct=EBI-10205543, EBI-739717;
CC       Q8NDC4:MORN4; NbExp=3; IntAct=EBI-10205543, EBI-10269566;
CC   -!- SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular
CC       matrix {ECO:0000269|PubMed:17074475}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=3;
CC       Name=1; Synonyms=CRTAC1-A;
CC         IsoId=Q9NQ79-1; Sequence=Displayed;
CC         Note=Shares an exon with the neighboring tail-to-tail oriented
CC         gene GOLGA7B.;
CC       Name=2; Synonyms=CRTAC1-B;
CC         IsoId=Q9NQ79-2; Sequence=VSP_010894, VSP_010895;
CC       Name=3;
CC         IsoId=Q9NQ79-3; Sequence=VSP_010893;
CC         Note=No experimental confirmation available.;
CC   -!- TISSUE SPECIFICITY: Expressed in the interterritorial matrix of
CC       articular deep zone cartilage (at protein level). Isoform 1 and
CC       isoform 2 are expressed in brain. Isoform 1 is detected in lung
CC       and chondrocytes. Detected in cartilage, bone, cultured
CC       chondrocytes and lung, and at low levels in heart. Not detected in
CC       osteoblasts. {ECO:0000269|PubMed:11139377,
CC       ECO:0000269|PubMed:17074475}.
CC   -!- INDUCTION: Up-regulated by BMP4 (at protein level). Up-regulated
CC       in mesenchymal stem cells undergoing chondrogenic differentiation
CC       and by BMP4. {ECO:0000269|PubMed:11139377}.
CC   -!- PTM: O-glycosylated. {ECO:0000269|PubMed:17074475}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=AAH34245.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
CC       Sequence=BAA91540.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
CC       Sequence=CAB98268.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
CC       Sequence=CAB98269.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
DR   EMBL; AJ276171; CAB98267.1; -; mRNA.
DR   EMBL; AJ276171; CAB98268.1; ALT_INIT; mRNA.
DR   EMBL; AJ276171; CAB98269.1; ALT_INIT; mRNA.
DR   EMBL; AK001182; BAA91540.1; ALT_INIT; mRNA.
DR   EMBL; AK292084; BAF84773.1; -; mRNA.
DR   EMBL; AL139239; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL358938; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AJ279016; CAC08451.1; -; mRNA.
DR   EMBL; AJ421515; CAD13394.1; -; mRNA.
DR   EMBL; BC034245; AAH34245.1; ALT_INIT; mRNA.
DR   CCDS; CCDS31266.1; -. [Q9NQ79-1]
DR   CCDS; CCDS55723.1; -. [Q9NQ79-2]
DR   RefSeq; NP_001193457.1; NM_001206528.2. [Q9NQ79-2]
DR   RefSeq; NP_060528.3; NM_018058.6. [Q9NQ79-1]
DR   UniGene; Hs.500736; -.
DR   ProteinModelPortal; Q9NQ79; -.
DR   BioGrid; 120427; 24.
DR   IntAct; Q9NQ79; 4.
DR   STRING; 9606.ENSP00000359629; -.
DR   iPTMnet; Q9NQ79; -.
DR   PhosphoSitePlus; Q9NQ79; -.
DR   BioMuta; CRTAC1; -.
DR   DMDM; 50400672; -.
DR   jPOST; Q9NQ79; -.
DR   PaxDb; Q9NQ79; -.
DR   PeptideAtlas; Q9NQ79; -.
DR   PRIDE; Q9NQ79; -.
DR   ProteomicsDB; 82098; -.
DR   ProteomicsDB; 82099; -. [Q9NQ79-2]
DR   ProteomicsDB; 82100; -. [Q9NQ79-3]
DR   DNASU; 55118; -.
DR   Ensembl; ENST00000370591; ENSP00000359623; ENSG00000095713. [Q9NQ79-2]
DR   Ensembl; ENST00000370597; ENSP00000359629; ENSG00000095713. [Q9NQ79-1]
DR   GeneID; 55118; -.
DR   KEGG; hsa:55118; -.
DR   UCSC; uc001kou.2; human. [Q9NQ79-1]
DR   CTD; 55118; -.
DR   DisGeNET; 55118; -.
DR   EuPathDB; HostDB:ENSG00000095713.13; -.
DR   GeneCards; CRTAC1; -.
DR   H-InvDB; HIX0035366; -.
DR   HGNC; HGNC:14882; CRTAC1.
DR   HPA; HPA008175; -.
DR   MIM; 606276; gene.
DR   neXtProt; NX_Q9NQ79; -.
DR   OpenTargets; ENSG00000095713; -.
DR   PharmGKB; PA26899; -.
DR   eggNOG; ENOG410IHAW; Eukaryota.
DR   eggNOG; ENOG410ZVH2; LUCA.
DR   GeneTree; ENSGT00390000013726; -.
DR   HOVERGEN; HBG051111; -.
DR   InParanoid; Q9NQ79; -.
DR   OMA; YAIYIAN; -.
DR   OrthoDB; 986490at2759; -.
DR   PhylomeDB; Q9NQ79; -.
DR   TreeFam; TF333171; -.
DR   ChiTaRS; CRTAC1; human.
DR   GenomeRNAi; 55118; -.
DR   PRO; PR:Q9NQ79; -.
DR   Proteomes; UP000005640; Chromosome 10.
DR   Bgee; ENSG00000095713; Expressed in 177 organ(s), highest expression level in tendon.
DR   ExpressionAtlas; Q9NQ79; baseline and differential.
DR   Genevisible; Q9NQ79; HS.
DR   GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB.
DR   GO; GO:0030426; C:growth cone; IEA:Ensembl.
DR   GO; GO:0005509; F:calcium ion binding; IEA:InterPro.
DR   GO; GO:0007413; P:axonal fasciculation; IEA:Ensembl.
DR   GO; GO:1900121; P:negative regulation of receptor binding; IEA:Ensembl.
DR   GO; GO:0021772; P:olfactory bulb development; IEA:Ensembl.
DR   InterPro; IPR027039; Crtac1.
DR   InterPro; IPR001881; EGF-like_Ca-bd_dom.
DR   InterPro; IPR018097; EGF_Ca-bd_CS.
DR   InterPro; IPR011519; UnbV_ASPIC.
DR   PANTHER; PTHR16026:SF4; PTHR16026:SF4; 1.
DR   Pfam; PF07645; EGF_CA; 1.
DR   Pfam; PF07593; UnbV_ASPIC; 1.
DR   SMART; SM00179; EGF_CA; 1.
DR   PROSITE; PS01187; EGF_CA; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; Complete proteome; Disulfide bond;
KW   EGF-like domain; Extracellular matrix; Glycoprotein; Polymorphism;
KW   Reference proteome; Repeat; Secreted; Signal.
FT   SIGNAL        1     27       {ECO:0000255}.
FT   CHAIN        28    661       Cartilage acidic protein 1.
FT                                /FTId=PRO_0000007497.
FT   REPEAT       46     88       FG-GAP 1; atypical.
FT   REPEAT      105    147       FG-GAP 2; atypical.
FT   REPEAT      283    333       FG-GAP 3; atypical.
FT   REPEAT      395    437       FG-GAP 4; atypical.
FT   DOMAIN      559    605       EGF-like.
FT   COMPBIAS    622    639       Ala-rich.
FT   CARBOHYD    608    608       O-linked (GalNAc...) threonine.
FT                                {ECO:0000255}.
FT   CARBOHYD    618    618       O-linked (GalNAc...) threonine.
FT                                {ECO:0000255}.
FT   CARBOHYD    619    619       O-linked (GalNAc...) threonine.
FT                                {ECO:0000255}.
FT   CARBOHYD    621    621       O-linked (GalNAc...) threonine.
FT                                {ECO:0000255}.
FT   CARBOHYD    626    626       O-linked (GalNAc...) threonine.
FT                                {ECO:0000255}.
FT   DISULFID    563    577       {ECO:0000255}.
FT   DISULFID    570    586       {ECO:0000255}.
FT   DISULFID    592    605       {ECO:0000255}.
FT   VAR_SEQ     545    661       CGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYR
FT                                CRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAAT
FT                                AAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC -> TP
FT                                MNASSSHSCALETSPYVSTPMEATGAGPTRSAVGATSPTRM
FT                                AQPAWGLSASHRAPAPPPPPLLLPLPLLLPLLELPLLHRSS
FT                                (in isoform 3).
FT                                {ECO:0000303|PubMed:14702039}.
FT                                /FTId=VSP_010893.
FT   VAR_SEQ     607    645       GTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDG
FT                                -> AQVAFLGGYSSAASRISEPLSRASYLSLGLGLCLQLYA
FT                                L (in isoform 2).
FT                                {ECO:0000303|PubMed:11139377}.
FT                                /FTId=VSP_010894.
FT   VAR_SEQ     646    661       Missing (in isoform 2).
FT                                {ECO:0000303|PubMed:11139377}.
FT                                /FTId=VSP_010895.
FT   VARIANT     253    253       A -> T (in dbSNP:rs35853031).
FT                                /FTId=VAR_048972.
FT   VARIANT     569    569       V -> M (in dbSNP:rs2297935).
FT                                /FTId=VAR_048973.
FT   VARIANT     658    658       E -> K (in dbSNP:rs56007204).
FT                                /FTId=VAR_061152.
FT   CONFLICT    454    454       F -> V (in Ref. 2; BAA91540).
FT                                {ECO:0000305}.
SQ   SEQUENCE   661 AA;  71421 MW;  2EF75321817F0D01 CRC64;
     MAPSADPGMS RMLPFLLLLW FLPITEGSQR AEPMFTAVTN SVLPPDYDSN PTQLNYGVAV
     TDVDHDGDFE IVVAGYNGPN LVLKYDRAQK RLVNIAVDER SSPYYALRDR QGNAIGVTAC
     DIDGDGREEI YFLNTNNAFS GVATYTDKLF KFRNNRWEDI LSDEVNVARG VASLFAGRSV
     ACVDRKGSGR YSIYIANYAY GNVGPDALIE MDPEASDLSR GILALRDVAA EAGVSKYTGG
     RGVSVGPILS SSASDIFCDN ENGPNFLFHN RGDGTFVDAA ASAGVDDPHQ HGRGVALADF
     NRDGKVDIVY GNWNGPHRLY LQMSTHGKVR FRDIASPKFS MPSPVRTVIT ADFDNDQELE
     IFFNNIAYRS SSANRLFRVI RREHGDPLIE ELNPGDALEP EGRGTGGVVT DFDGDGMLDL
     ILSHGESMAQ PLSVFRGNQG FNNNWLRVVP RTRFGAFARG AKVVLYTKKS GAHLRIIDGG
     SGYLCEMEPV AHFGLGKDEA SSVEVTWPDG KMVSRNVASG EMNSVLEILY PRDEDTLQDP
     APLECGQGFS QQENGHCMDT NECIQFPFVC PRDKPVCVNT YGSYRCRTNK KCSRGYEPNE
     DGTACVGTLG QSPGPRPTTP TAAAATAAAA AAAGAATAAP VLVDGDLNLG SVVKESCEPS
     C
//
DBGET integrated database retrieval system