GenomeNet

Database: UniProt
Entry: Q9UDY6
LinkDB: Q9UDY6
Original site: Q9UDY6 
ID   TRI10_HUMAN             Reviewed;         481 AA.
AC   Q9UDY6; A6NF84; Q5SRJ5; Q5SRK8; Q86Z08; Q96QB6; Q9C023; Q9C024;
DT   26-SEP-2001, integrated into UniProtKB/Swiss-Prot.
DT   19-JUL-2004, sequence version 3.
DT   13-FEB-2019, entry version 179.
DE   RecName: Full=Tripartite motif-containing protein 10;
DE   AltName: Full=B30-RING finger protein;
DE   AltName: Full=RING finger protein 9;
GN   Name=TRIM10; Synonyms=RFB30, RNF9;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM ALPHA).
RC   TISSUE=Testis;
RX   PubMed=9271628; DOI=10.1007/s002510050292;
RA   Henry J., Ribouchon M.-T., Depetris D., Mattei M.-G., Offer C.,
RA   Tazi-Ahnini R., Pontarotti P.;
RT   "Cloning, structural analysis, and mapping of the B30 and B7
RT   multigenic families to the major histocompatibility complex (MHC) and
RT   other chromosomal regions.";
RL   Immunogenetics 46:383-395(1997).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA), AND SUBCELLULAR
RP   LOCATION.
RX   PubMed=11331580; DOI=10.1093/emboj/20.9.2140;
RA   Reymond A., Meroni G., Fantozzi A., Merla G., Cairo S., Luzi L.,
RA   Riganelli D., Zanaria E., Messali S., Cainarca S., Guffanti A.,
RA   Minucci S., Pelicci P.G., Ballabio A.;
RT   "The tripartite motif family identifies cell compartments.";
RL   EMBO J. 20:2140-2151(2001).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA].
RC   TISSUE=Peripheral blood leukocyte;
RX   PubMed=16702430; DOI=10.1534/genetics.106.057034;
RA   Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M.,
RA   Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K.,
RA   Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y.,
RA   Meyer A., Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K.,
RA   Gojobori T., Inoko H., Bahram S.;
RT   "Rapid evolution of major histocompatibility complex class I genes in
RT   primates generates new disease alleles in humans via hitchhiking
RT   diversity.";
RL   Genetics 173:1555-1570(2006).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Shiina S., Tamiya G., Oka A., Inoko H.;
RT   "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.";
RL   Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases.
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Shiina T., Ota M., Katsuyama Y., Hashimoto N., Inoko H.;
RT   "Genome diversity in HLA: a new strategy for detection of genetic
RT   polymorphisms in expressed genes within the HLA class III and class I
RT   regions.";
RL   Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases.
RN   [6]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=14574404; DOI=10.1038/nature02055;
RA   Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L.,
RA   Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E.,
RA   Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R.,
RA   Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S.,
RA   Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J.,
RA   Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P.,
RA   Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y.,
RA   Burford D.C., Burrill W., Burton J., Carder C., Carter N.P.,
RA   Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V.,
RA   Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J.,
RA   Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E.,
RA   Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A.,
RA   Frankland J., French L., Garner P., Garnett J., Ghori M.J.,
RA   Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M.,
RA   Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S.,
RA   Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R.,
RA   Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E.,
RA   Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A.,
RA   Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C.,
RA   Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M.,
RA   Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M.,
RA   Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K.,
RA   McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T.,
RA   Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R.,
RA   Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W.,
RA   Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M.,
RA   Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L.,
RA   Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J.,
RA   Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B.,
RA   Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L.,
RA   Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W.,
RA   Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A.,
RA   Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.;
RT   "The DNA sequence and analysis of human chromosome 6.";
RL   Nature 425:805-811(2003).
RN   [7]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
RA   Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
RA   Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
RA   Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
RA   Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
RA   Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
RA   Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
RA   Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [8]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BETA).
RC   TISSUE=Liver;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
CC   -!- FUNCTION: Seems to play an important role in erythropoiesis.
CC       {ECO:0000250}.
CC   -!- INTERACTION:
CC       P25786:PSMA1; NbExp=3; IntAct=EBI-6427325, EBI-359352;
CC       Q5W5X9:TTC23; NbExp=3; IntAct=EBI-6427325, EBI-6447954;
CC       Q9UQR1:ZNF148; NbExp=3; IntAct=EBI-6427325, EBI-2688184;
CC   -!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:11331580}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=Alpha;
CC         IsoId=Q9UDY6-1; Sequence=Displayed;
CC       Name=Beta;
CC         IsoId=Q9UDY6-2; Sequence=VSP_005748;
CC         Note=Ref.2 (AAG53496) sequence is in conflict in position:
CC         379:C->G. {ECO:0000305};
CC   -!- SIMILARITY: Belongs to the TRIM/RBCC family. {ECO:0000305}.
DR   EMBL; Y07829; CAB52384.1; -; Genomic_DNA.
DR   EMBL; AF220122; AAG53495.1; -; mRNA.
DR   EMBL; AF220123; AAG53496.1; -; mRNA.
DR   EMBL; AB202085; BAE78605.1; -; Genomic_DNA.
DR   EMBL; AB103595; BAF31256.1; -; Genomic_DNA.
DR   EMBL; BA000025; BAB63332.1; -; Genomic_DNA.
DR   EMBL; AB088089; BAC54921.1; -; Genomic_DNA.
DR   EMBL; AL669914; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL671859; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL844220; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BX005441; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BX927221; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CR753815; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CR759838; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CR788282; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471081; EAX03268.1; -; Genomic_DNA.
DR   EMBL; CH471081; EAX03269.1; -; Genomic_DNA.
DR   EMBL; BC093926; AAH93926.1; -; mRNA.
DR   EMBL; BC113419; AAI13420.1; -; mRNA.
DR   CCDS; CCDS34375.1; -. [Q9UDY6-1]
DR   CCDS; CCDS4676.1; -. [Q9UDY6-2]
DR   RefSeq; NP_006769.2; NM_006778.3. [Q9UDY6-1]
DR   RefSeq; NP_439893.2; NM_052828.2. [Q9UDY6-2]
DR   UniGene; Hs.709483; -.
DR   ProteinModelPortal; Q9UDY6; -.
DR   SMR; Q9UDY6; -.
DR   BioGrid; 115413; 26.
DR   IntAct; Q9UDY6; 12.
DR   STRING; 9606.ENSP00000397073; -.
DR   PhosphoSitePlus; Q9UDY6; -.
DR   BioMuta; TRIM10; -.
DR   DMDM; 50403805; -.
DR   EPD; Q9UDY6; -.
DR   jPOST; Q9UDY6; -.
DR   PaxDb; Q9UDY6; -.
DR   PeptideAtlas; Q9UDY6; -.
DR   PRIDE; Q9UDY6; -.
DR   ProteomicsDB; 84134; -.
DR   ProteomicsDB; 84135; -. [Q9UDY6-2]
DR   Ensembl; ENST00000259941; ENSP00000259941; ENSG00000137394. [Q9UDY6-2]
DR   Ensembl; ENST00000354038; ENSP00000343695; ENSG00000137394. [Q9UDY6-1]
DR   Ensembl; ENST00000376704; ENSP00000365894; ENSG00000204613. [Q9UDY6-2]
DR   Ensembl; ENST00000413055; ENSP00000393787; ENSG00000227472. [Q9UDY6-2]
DR   Ensembl; ENST00000416714; ENSP00000405578; ENSG00000229381. [Q9UDY6-2]
DR   Ensembl; ENST00000417411; ENSP00000393576; ENSG00000237192. [Q9UDY6-2]
DR   Ensembl; ENST00000426996; ENSP00000397440; ENSG00000227472. [Q9UDY6-1]
DR   Ensembl; ENST00000428611; ENSP00000412370; ENSG00000229346. [Q9UDY6-2]
DR   Ensembl; ENST00000431258; ENSP00000395598; ENSG00000235025. [Q9UDY6-1]
DR   Ensembl; ENST00000446013; ENSP00000398404; ENSG00000237703. [Q9UDY6-2]
DR   Ensembl; ENST00000447465; ENSP00000393976; ENSG00000235025. [Q9UDY6-2]
DR   Ensembl; ENST00000448645; ENSP00000399446; ENSG00000229346. [Q9UDY6-1]
DR   Ensembl; ENST00000449208; ENSP00000390497; ENSG00000237703. [Q9UDY6-1]
DR   Ensembl; ENST00000449742; ENSP00000397073; ENSG00000204613. [Q9UDY6-1]
DR   Ensembl; ENST00000451727; ENSP00000391445; ENSG00000237192. [Q9UDY6-1]
DR   Ensembl; ENST00000456988; ENSP00000410849; ENSG00000229381. [Q9UDY6-1]
DR   GeneID; 10107; -.
DR   KEGG; hsa:10107; -.
DR   UCSC; uc003npn.3; human. [Q9UDY6-1]
DR   CTD; 10107; -.
DR   DisGeNET; 10107; -.
DR   EuPathDB; HostDB:ENSG00000204613.10; -.
DR   GeneCards; TRIM10; -.
DR   H-InvDB; HIX0032788; -.
DR   HGNC; HGNC:10072; TRIM10.
DR   HPA; HPA043325; -.
DR   MIM; 605701; gene.
DR   neXtProt; NX_Q9UDY6; -.
DR   OpenTargets; ENSG00000204613; -.
DR   PharmGKB; PA35536; -.
DR   eggNOG; KOG2177; Eukaryota.
DR   eggNOG; ENOG4111G04; LUCA.
DR   GeneTree; ENSGT00940000161525; -.
DR   HOGENOM; HOG000234133; -.
DR   HOVERGEN; HBG001357; -.
DR   InParanoid; Q9UDY6; -.
DR   KO; K12002; -.
DR   OMA; DEMQLCV; -.
DR   OrthoDB; 1334551at2759; -.
DR   PhylomeDB; Q9UDY6; -.
DR   TreeFam; TF342569; -.
DR   Reactome; R-HSA-877300; Interferon gamma signaling.
DR   ChiTaRS; TRIM10; human.
DR   GenomeRNAi; 10107; -.
DR   PRO; PR:Q9UDY6; -.
DR   Proteomes; UP000005640; Chromosome 6.
DR   Bgee; ENSG00000204613; Expressed in 54 organ(s), highest expression level in liver.
DR   ExpressionAtlas; Q9UDY6; baseline and differential.
DR   Genevisible; Q9UDY6; HS.
DR   GO; GO:0005737; C:cytoplasm; ISS:UniProtKB.
DR   GO; GO:0008270; F:zinc ion binding; IEA:InterPro.
DR   GO; GO:0030218; P:erythrocyte differentiation; IEA:Ensembl.
DR   GO; GO:0045087; P:innate immune response; IEA:Ensembl.
DR   GO; GO:0046597; P:negative regulation of viral entry into host cell; IEA:Ensembl.
DR   CDD; cd00021; BBOX; 1.
DR   Gene3D; 3.30.40.10; -; 1.
DR   InterPro; IPR001870; B30.2/SPRY.
DR   InterPro; IPR003879; Butyrophylin_SPRY.
DR   InterPro; IPR013320; ConA-like_dom_sf.
DR   InterPro; IPR006574; PRY.
DR   InterPro; IPR003877; SPRY_dom.
DR   InterPro; IPR000315; Znf_B-box.
DR   InterPro; IPR001841; Znf_RING.
DR   InterPro; IPR013083; Znf_RING/FYVE/PHD.
DR   InterPro; IPR017907; Znf_RING_CS.
DR   Pfam; PF13765; PRY; 1.
DR   Pfam; PF00622; SPRY; 1.
DR   Pfam; PF00643; zf-B_box; 1.
DR   PRINTS; PR01407; BUTYPHLNCDUF.
DR   SMART; SM00336; BBOX; 1.
DR   SMART; SM00589; PRY; 1.
DR   SMART; SM00184; RING; 1.
DR   SMART; SM00449; SPRY; 1.
DR   SUPFAM; SSF49899; SSF49899; 1.
DR   PROSITE; PS50188; B302_SPRY; 1.
DR   PROSITE; PS50119; ZF_BBOX; 1.
DR   PROSITE; PS00518; ZF_RING_1; 1.
DR   PROSITE; PS50089; ZF_RING_2; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; Coiled coil; Complete proteome; Cytoplasm;
KW   Metal-binding; Polymorphism; Reference proteome; Zinc; Zinc-finger.
FT   CHAIN         1    481       Tripartite motif-containing protein 10.
FT                                /FTId=PRO_0000056211.
FT   DOMAIN      292    481       B30.2/SPRY. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00548}.
FT   ZN_FING      16     61       RING-type. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00175}.
FT   ZN_FING      94    135       B box-type. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00024}.
FT   COILED      150    177       {ECO:0000255}.
FT   VAR_SEQ     369    481       VSIDLAHGGSCTVGVVSEDVQRKGELRLRPEEGVWAVRLAW
FT                                GFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFTNAVTR
FT                                EPIYTFTASFTRKVIPFFGLWGRGSSFSLSS -> WMARVP
FT                                GDSGCCQFCSPPSVLGTEVAA (in isoform Beta).
FT                                {ECO:0000303|PubMed:11331580,
FT                                ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_005748.
FT   VARIANT      65     65       R -> H (in dbSNP:rs12212092).
FT                                /FTId=VAR_052127.
FT   VARIANT     119    119       V -> M (in dbSNP:rs17194446).
FT                                /FTId=VAR_052128.
FT   CONFLICT    104    104       E -> G (in Ref. 1; CAB52384).
FT                                {ECO:0000305}.
FT   CONFLICT    104    104       E -> SR (in Ref. 2; AAG53495/AAG53496).
FT                                {ECO:0000305}.
FT   CONFLICT    167    167       E -> K (in Ref. 2; AAG53495/AAG53496).
FT                                {ECO:0000305}.
FT   CONFLICT    336    336       Y -> S (in Ref. 1; CAB52384 and 2;
FT                                AAG53495). {ECO:0000305}.
FT   CONFLICT    377    377       G -> A (in Ref. 1; CAB52384 and 2;
FT                                AAG53495). {ECO:0000305}.
SQ   SEQUENCE   481 AA;  55037 MW;  49A1A11F391F5F98 CRC64;
     MASAASVTSL ADEVNCPICQ GTLREPVTID CGHNFCRACL TRYCEIPGPD LEESPTCPLC
     KEPFRPGSFR PNWQLANVVE NIERLQLVST LGLGEEDVCQ EHGEKIYFFC EDDEMQLCVV
     CREAGEHATH TMRFLEDAAA PYREQIHKCL KCLRKEREEI QEIQSRENKR MQVLLTQVST
     KRQQVISEFA HLRKFLEEQQ SILLAQLESQ DGDILRQRDE FDLLVAGEIC RFSALIEELE
     EKNERPAREL LTDIRSTLIR CETRKCRKPV AVSPELGQRI RDFPQQALPL QREMKMFLEK
     LCFELDYEPA HISLDPQTSH PKLLLSEDHQ RAQFSYKWQN SPDNPQRFDR ATCVLAHTGI
     TGGRHTWVVS IDLAHGGSCT VGVVSEDVQR KGELRLRPEE GVWAVRLAWG FVSALGSFPT
     RLTLKEQPRQ VRVSLDYEVG WVTFTNAVTR EPIYTFTASF TRKVIPFFGL WGRGSSFSLS
     S
//
DBGET integrated database retrieval system