GenomeNet

Database: UniProt
Entry: Q9Y603
LinkDB: Q9Y603
Original site: Q9Y603 
ID   ETV7_HUMAN              Reviewed;         341 AA.
AC   Q9Y603; B3KVC2; B4DVB6; B4E1G4; Q5R3L3; Q5R3L4; Q9NZ65; Q9NZ66; Q9NZ68;
AC   Q9NZR8; Q9UNJ7; Q9Y5K4; Q9Y604;
DT   21-FEB-2001, integrated into UniProtKB/Swiss-Prot.
DT   01-NOV-1999, sequence version 1.
DT   07-OCT-2020, entry version 180.
DE   RecName: Full=Transcription factor ETV7;
DE   AltName: Full=ETS translocation variant 7;
DE   AltName: Full=ETS-related protein Tel2;
DE   AltName: Full=Tel-related Ets factor;
DE   AltName: Full=Transcription factor Tel-2;
GN   Name=ETV7; Synonyms=TEL2, TELB, TREF;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B), AND CHARACTERIZATION.
RC   TISSUE=Hematopoietic;
RX   PubMed=10828014;
RA   Potter M.D., Buijs A., Kreider B., van Rompaey L., Grosveld G.C.;
RT   "Identification and characterization of a new human ETS-family
RT   transcription factor, TEL2, that is expressed in hematopoietic tissues and
RT   can associate with TEL1/ETV6.";
RL   Blood 95:3341-3348(2000).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D; E AND F), AND
RP   CHARACTERIZATION.
RC   TISSUE=Pancreas;
RX   PubMed=11108721; DOI=10.1074/jbc.m010070200;
RA   Gu X., Shin B.-H., Akbarali Y., Weiss A., Boltax J., Oettgen P.,
RA   Libermann T.A.;
RT   "Tel-2, a novel transcriptional repressor related to the Ets factor
RT   Tel/ETV-6.";
RL   J. Biol. Chem. 276:9421-9436(2001).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM G).
RA   Smith J.L., Ostrowski M.C.;
RT   "TREF-a Tel related Ets factor.";
RL   Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases.
RN   [4]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
RX   PubMed=11032031; DOI=10.1038/sj.onc.1203830;
RA   Poirel H., Lopez R.G., Lacronique V., Della Valle V., Mauchauffe M.,
RA   Berger R., Ghysdael J., Bernard O.A.;
RT   "Characterization of a novel ETS gene, TELB encoding a protein structurally
RT   and functionally related to TEL.";
RL   Oncogene 19:4802-4806(2000).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS B; D AND H).
RC   TISSUE=Lung, Small intestine, and Thymus;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
RA   Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
RA   Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
RA   Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
RA   Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
RA   Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
RA   Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
RA   Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
RA   Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
RA   Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
RA   Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
RA   Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [6]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=14574404; DOI=10.1038/nature02055;
RA   Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L.,
RA   Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R.,
RA   Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D.,
RA   Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J.,
RA   Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H.,
RA   Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J.,
RA   Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P.,
RA   Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V.,
RA   Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J.,
RA   Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E.,
RA   Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J.,
RA   French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J.,
RA   Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C.,
RA   Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A.,
RA   Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R.,
RA   Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M.,
RA   Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K.,
RA   Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R.,
RA   Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M.,
RA   Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A.,
RA   Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L.,
RA   Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I.,
RA   Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y.,
RA   Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E.,
RA   Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A.,
RA   Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W.,
RA   Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M.,
RA   West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J.,
RA   Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M.,
RA   Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I.,
RA   Rogers J., Beck S.;
RT   "The DNA sequence and analysis of human chromosome 6.";
RL   Nature 425:805-811(2003).
RN   [7]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
RA   Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
RA   Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
RA   Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
RA   Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
RA   Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
RA   Hunkapiller M.W., Myers E.W., Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [8]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
RC   TISSUE=Brain;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA project:
RT   the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
CC   -!- FUNCTION: Transcriptional repressor; binds to the DNA sequence 5'-
CC       CCGGAAGT-3'. Isoform A does not seem to have a repressor activity.
CC       Isoform C does not seem to have a repressor activity.
CC   -!- SUBCELLULAR LOCATION: Nucleus.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=8;
CC       Name=B;
CC         IsoId=Q9Y603-1; Sequence=Displayed;
CC       Name=A;
CC         IsoId=Q9Y603-2; Sequence=VSP_001473;
CC       Name=C;
CC         IsoId=Q9Y603-3; Sequence=VSP_001474;
CC       Name=D;
CC         IsoId=Q9Y603-4; Sequence=VSP_001475;
CC       Name=E;
CC         IsoId=Q9Y603-5; Sequence=VSP_001477;
CC       Name=F;
CC         IsoId=Q9Y603-6; Sequence=VSP_001475, VSP_001477;
CC       Name=G;
CC         IsoId=Q9Y603-7; Sequence=VSP_001476;
CC       Name=H;
CC         IsoId=Q9Y603-8; Sequence=VSP_044285;
CC   -!- TISSUE SPECIFICITY: Expressed in hematopoietic tissues.
CC   -!- SIMILARITY: Belongs to the ETS family. {ECO:0000305}.
DR   EMBL; AF116508; AAD43250.1; -; mRNA.
DR   EMBL; AF116509; AAD43251.1; -; mRNA.
DR   EMBL; AF116510; AAD43252.1; -; mRNA.
DR   EMBL; AF218235; AAF28350.1; -; mRNA.
DR   EMBL; AF218365; AAF44742.1; -; mRNA.
DR   EMBL; AF218366; AAF44743.1; -; mRNA.
DR   EMBL; AF175387; AAF25007.3; -; mRNA.
DR   EMBL; AF147782; AAD33989.1; -; mRNA.
DR   EMBL; AJ276205; CAC17012.1; -; mRNA.
DR   EMBL; AK122796; BAG53734.1; -; mRNA.
DR   EMBL; AK301011; BAG62628.1; -; mRNA.
DR   EMBL; AK303829; BAG64776.1; -; mRNA.
DR   EMBL; Z84484; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471081; EAX03885.1; -; Genomic_DNA.
DR   EMBL; CH471081; EAX03888.1; -; Genomic_DNA.
DR   EMBL; CH471081; EAX03890.1; -; Genomic_DNA.
DR   EMBL; BC035853; AAH35853.1; -; mRNA.
DR   CCDS; CCDS4819.1; -. [Q9Y603-1]
DR   CCDS; CCDS56422.1; -. [Q9Y603-8]
DR   CCDS; CCDS56423.1; -. [Q9Y603-4]
DR   CCDS; CCDS56424.1; -. [Q9Y603-7]
DR   CCDS; CCDS56425.1; -. [Q9Y603-5]
DR   CCDS; CCDS75440.1; -. [Q9Y603-2]
DR   CCDS; CCDS75441.1; -. [Q9Y603-3]
DR   CCDS; CCDS78131.1; -. [Q9Y603-6]
DR   RefSeq; NP_001193964.1; NM_001207035.1. [Q9Y603-5]
DR   RefSeq; NP_001193965.1; NM_001207036.1. [Q9Y603-4]
DR   RefSeq; NP_001193966.1; NM_001207037.1. [Q9Y603-2]
DR   RefSeq; NP_001193967.1; NM_001207038.1. [Q9Y603-7]
DR   RefSeq; NP_001193968.1; NM_001207039.1. [Q9Y603-6]
DR   RefSeq; NP_001193969.1; NM_001207040.1. [Q9Y603-3]
DR   RefSeq; NP_001193970.1; NM_001207041.1. [Q9Y603-8]
DR   RefSeq; NP_057219.1; NM_016135.3. [Q9Y603-1]
DR   SMR; Q9Y603; -.
DR   BioGRID; 119581; 7.
DR   IntAct; Q9Y603; 6.
DR   MINT; Q9Y603; -.
DR   STRING; 9606.ENSP00000341843; -.
DR   iPTMnet; Q9Y603; -.
DR   PhosphoSitePlus; Q9Y603; -.
DR   BioMuta; ETV7; -.
DR   DMDM; 13124589; -.
DR   MassIVE; Q9Y603; -.
DR   PaxDb; Q9Y603; -.
DR   PeptideAtlas; Q9Y603; -.
DR   PRIDE; Q9Y603; -.
DR   ProteomicsDB; 5258; -.
DR   ProteomicsDB; 86561; -. [Q9Y603-1]
DR   ProteomicsDB; 86562; -. [Q9Y603-2]
DR   ProteomicsDB; 86563; -. [Q9Y603-3]
DR   ProteomicsDB; 86564; -. [Q9Y603-4]
DR   ProteomicsDB; 86565; -. [Q9Y603-5]
DR   ProteomicsDB; 86566; -. [Q9Y603-6]
DR   ProteomicsDB; 86567; -. [Q9Y603-7]
DR   Antibodypedia; 15369; 284 antibodies.
DR   DNASU; 51513; -.
DR   Ensembl; ENST00000339796; ENSP00000342260; ENSG00000010030. [Q9Y603-5]
DR   Ensembl; ENST00000340181; ENSP00000341843; ENSG00000010030. [Q9Y603-1]
DR   Ensembl; ENST00000373737; ENSP00000362842; ENSG00000010030. [Q9Y603-7]
DR   Ensembl; ENST00000373738; ENSP00000362843; ENSG00000010030. [Q9Y603-4]
DR   Ensembl; ENST00000538992; ENSP00000440592; ENSG00000010030. [Q9Y603-8]
DR   Ensembl; ENST00000615781; ENSP00000481885; ENSG00000010030. [Q9Y603-2]
DR   Ensembl; ENST00000620358; ENSP00000484485; ENSG00000010030. [Q9Y603-3]
DR   Ensembl; ENST00000627426; ENSP00000486712; ENSG00000010030. [Q9Y603-6]
DR   GeneID; 51513; -.
DR   KEGG; hsa:51513; -.
DR   UCSC; uc003olz.3; human. [Q9Y603-1]
DR   CTD; 51513; -.
DR   DisGeNET; 51513; -.
DR   EuPathDB; HostDB:ENSG00000010030.13; -.
DR   GeneCards; ETV7; -.
DR   HGNC; HGNC:18160; ETV7.
DR   HPA; ENSG00000010030; Tissue enhanced (intestine).
DR   MIM; 605255; gene.
DR   neXtProt; NX_Q9Y603; -.
DR   OpenTargets; ENSG00000010030; -.
DR   PharmGKB; PA134980006; -.
DR   eggNOG; KOG3804; Eukaryota.
DR   GeneTree; ENSGT00940000162211; -.
DR   HOGENOM; CLU_037998_0_0_1; -.
DR   InParanoid; Q9Y603; -.
DR   KO; K03211; -.
DR   OMA; RIQPSLW; -.
DR   OrthoDB; 827924at2759; -.
DR   PhylomeDB; Q9Y603; -.
DR   TreeFam; TF318679; -.
DR   PathwayCommons; Q9Y603; -.
DR   BioGRID-ORCS; 51513; 4 hits in 894 CRISPR screens.
DR   GeneWiki; ETV7; -.
DR   GenomeRNAi; 51513; -.
DR   Pharos; Q9Y603; Tbio.
DR   PRO; PR:Q9Y603; -.
DR   Proteomes; UP000005640; Chromosome 6.
DR   RNAct; Q9Y603; protein.
DR   Bgee; ENSG00000010030; Expressed in buccal mucosa cell and 204 other tissues.
DR   Genevisible; Q9Y603; HS.
DR   GO; GO:0042025; C:host cell nucleus; IEA:InterPro.
DR   GO; GO:0000790; C:nuclear chromatin; ISA:NTNU_SB.
DR   GO; GO:0005654; C:nucleoplasm; IDA:HPA.
DR   GO; GO:0005634; C:nucleus; IBA:GO_Central.
DR   GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; ISA:NTNU_SB.
DR   GO; GO:0001227; F:DNA-binding transcription repressor activity, RNA polymerase II-specific; IDA:NTNU_SB.
DR   GO; GO:0000977; F:RNA polymerase II transcription regulatory region sequence-specific DNA binding; IDA:NTNU_SB.
DR   GO; GO:1990837; F:sequence-specific double-stranded DNA binding; IDA:ARUK-UCL.
DR   GO; GO:0009887; P:animal organ morphogenesis; TAS:ProtInc.
DR   GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
DR   GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; IDA:NTNU_SB.
DR   GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IBA:GO_Central.
DR   GO; GO:0006366; P:transcription by RNA polymerase II; TAS:ProtInc.
DR   Gene3D; 1.10.10.10; -; 1.
DR   Gene3D; 1.10.150.50; -; 1.
DR   InterPro; IPR000418; Ets_dom.
DR   InterPro; IPR003118; Pointed_dom.
DR   InterPro; IPR013761; SAM/pointed_sf.
DR   InterPro; IPR036388; WH-like_DNA-bd_sf.
DR   InterPro; IPR036390; WH_DNA-bd_sf.
DR   Pfam; PF00178; Ets; 1.
DR   Pfam; PF02198; SAM_PNT; 1.
DR   PRINTS; PR00454; ETSDOMAIN.
DR   SMART; SM00413; ETS; 1.
DR   SMART; SM00251; SAM_PNT; 1.
DR   SUPFAM; SSF46785; SSF46785; 1.
DR   SUPFAM; SSF47769; SSF47769; 1.
DR   PROSITE; PS00346; ETS_DOMAIN_2; 1.
DR   PROSITE; PS50061; ETS_DOMAIN_3; 1.
DR   PROSITE; PS51433; PNT; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; DNA-binding; Nucleus; Polymorphism;
KW   Reference proteome; Repressor; Transcription; Transcription regulation.
FT   CHAIN           1..341
FT                   /note="Transcription factor ETV7"
FT                   /id="PRO_0000204123"
FT   DOMAIN          33..117
FT                   /note="PNT"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00762"
FT   DNA_BIND        224..305
FT                   /note="ETS"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00237"
FT   VAR_SEQ         1..151
FT                   /note="Missing (in isoform H)"
FT                   /evidence="ECO:0000303|PubMed:14702039"
FT                   /id="VSP_044285"
FT   VAR_SEQ         1..102
FT                   /note="MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPA
FT                   LWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSS -> MHRGA
FT                   RVRDERTRPLHPHQGRLPAPCAQLRSGKRTGFPLSGNP (in isoform A)"
FT                   /evidence="ECO:0000303|PubMed:11108721"
FT                   /id="VSP_001473"
FT   VAR_SEQ         1..81
FT                   /note="Missing (in isoform C)"
FT                   /evidence="ECO:0000303|PubMed:11108721"
FT                   /id="VSP_001474"
FT   VAR_SEQ         49..103
FT                   /note="Missing (in isoform D and isoform F)"
FT                   /evidence="ECO:0000303|PubMed:11108721,
FT                   ECO:0000303|PubMed:14702039"
FT                   /id="VSP_001475"
FT   VAR_SEQ         145..221
FT                   /note="Missing (in isoform G)"
FT                   /evidence="ECO:0000303|Ref.3"
FT                   /id="VSP_001476"
FT   VAR_SEQ         304..341
FT                   /note="FLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP -> NGLQLIFIFI
FT                   WSFQ (in isoform E and isoform F)"
FT                   /evidence="ECO:0000303|PubMed:11108721"
FT                   /id="VSP_001477"
FT   VARIANT         86
FT                   /note="A -> T (in dbSNP:rs9394345)"
FT                   /id="VAR_059257"
FT   VARIANT         138
FT                   /note="H -> Y (in dbSNP:rs9470262)"
FT                   /id="VAR_048952"
FT   VARIANT         199
FT                   /note="G -> S (in dbSNP:rs34306145)"
FT                   /id="VAR_048953"
FT   VARIANT         212
FT                   /note="P -> L (in dbSNP:rs2234079)"
FT                   /id="VAR_020314"
FT   VARIANT         250
FT                   /note="A -> V (in dbSNP:rs2234080)"
FT                   /id="VAR_048954"
FT   CONFLICT        27
FT                   /note="R -> T (in Ref. 1; AAF25007)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        255
FT                   /note="V -> G (in Ref. 1; AAF25007)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        273
FT                   /note="N -> D (in Ref. 1; AAF25007)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        311
FT                   /note="M -> T (in Ref. 1; AAF25007)"
FT                   /evidence="ECO:0000305"
SQ   SEQUENCE   341 AA;  38998 MW;  941983E83E45EBED CRC64;
     MQEGELAISP ISPVAAMPPL GTHVQARCEA QINLLGEGGI CKLPGRLRIQ PALWSREDVL
     HWLRWAEQEY SLPCTAEHGF EMNGRALCIL TKDDFRHRAP SSGDVLYELL QYIKTQRRAL
     VCGPFFGGIF RLKTPTQHSP VPPEEVTGPS QMDTRRGHLL QPPDPGLTSN FGHLDDPGLA
     RWTPGKEESL NLCHCAELGC RTQGVCSFPA MPQAPIDGRI ADCRLLWDYV YQLLLDTRYE
     PYIKWEDKDA KIFRVVDPNG LARLWGNHKN RVNMTYEKMS RALRHYYKLN IIKKEPGQKL
     LFRFLKTPGK MVQDKHSHLE PLESQEQDRI EFKDKRPEIS P
//
DBGET integrated database retrieval system