GenomeNet

Database: UniProt
Entry: TEDC1_HUMAN
LinkDB: TEDC1_HUMAN
Original site: TEDC1_HUMAN 
ID   TEDC1_HUMAN             Reviewed;         495 AA.
AC   Q86SX3; B5MDG3; E9PAQ4; Q86TT3; Q86TT4; Q86TT5; Q96B41; Q9H7H4;
DT   29-APR-2008, integrated into UniProtKB/Swiss-Prot.
DT   29-APR-2008, sequence version 2.
DT   17-JUN-2020, entry version 119.
DE   RecName: Full=Tubulin epsilon and delta complex protein 1 {ECO:0000305};
GN   Name=TEDC1 {ECO:0000312|HGNC:HGNC:20127};
GN   Synonyms=C14orf80 {ECO:0000312|HGNC:HGNC:20127};
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 5).
RC   TISSUE=Cervix carcinoma, and Placenta;
RA   Li W.B., Gruber C., Jessee J., Polayes D.;
RT   "Full-length cDNA libraries and normalization.";
RL   Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases.
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=12508121; DOI=10.1038/nature01348;
RA   Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C.,
RA   Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A.,
RA   Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H.,
RA   Du H., Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T.,
RA   Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B.,
RA   Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D.,
RA   Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R.,
RA   Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S.,
RA   Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C.,
RA   Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S.,
RA   Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C.,
RA   Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P.,
RA   Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M.,
RA   Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V.,
RA   Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J.,
RA   Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F.,
RA   Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F.,
RA   Waterston R., Hood L., Weissenbach J.;
RT   "The DNA sequence and analysis of human chromosome 14.";
RL   Nature 421:601-607(2003).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
RA   Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
RA   Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
RA   Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
RA   Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
RA   Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
RA   Hunkapiller M.W., Myers E.W., Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
RC   TISSUE=Uterus;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA project:
RT   the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 327-495.
RC   TISSUE=Spleen;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
RA   Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
RA   Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
RA   Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
RA   Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
RA   Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
RA   Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
RA   Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
RA   Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
RA   Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
RA   Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
RA   Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [6]
RP   FUNCTION.
RX   PubMed=28796488; DOI=10.1021/acschembio.7b00385;
RA   Filipuzzi I., Thomas J.R., Pries V., Estoppey D., Salcius M., Studer C.,
RA   Schirle M., Hoepfner D.;
RT   "Direct Interaction of Chivosazole F with Actin Elicits Cell Responses
RT   Similar to Latrunculin A but Distinct from Chondramide.";
RL   ACS Chem. Biol. 12:2264-2269(2017).
CC   -!- FUNCTION: Acts as a positive regulator of ciliary hedgehog signaling.
CC       Required for centriole stability (By similarity). May play a role in
CC       counteracting perturbation of actin filaments, such as after treatment
CC       with the actin depolymerizing microbial metabolite Chivosazole F
CC       (PubMed:28796488). {ECO:0000250|UniProtKB:Q3UK37,
CC       ECO:0000269|PubMed:28796488}.
CC   -!- SUBUNIT: Interacts with TEDC2. Found in a complex with TEDC1, TEDC2,
CC       TUBE1 and TUBD1. {ECO:0000250|UniProtKB:Q3UK37}.
CC   -!- INTERACTION:
CC       Q86SX3; P35638: DDIT3; NbExp=2; IntAct=EBI-3247115, EBI-742651;
CC   -!- SUBCELLULAR LOCATION: Cell projection, cilium
CC       {ECO:0000250|UniProtKB:Q3UK37}. Cytoplasm, cytoskeleton, microtubule
CC       organizing center, centrosome, centriole
CC       {ECO:0000250|UniProtKB:Q3UK37}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=6;
CC       Name=1;
CC         IsoId=Q86SX3-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q86SX3-2; Sequence=VSP_033065;
CC       Name=3;
CC         IsoId=Q86SX3-3; Sequence=VSP_033063, VSP_033065;
CC       Name=4;
CC         IsoId=Q86SX3-4; Sequence=VSP_033062, VSP_033064, VSP_033066;
CC       Name=5;
CC         IsoId=Q86SX3-5; Sequence=VSP_045690, VSP_033065;
CC       Name=6;
CC         IsoId=Q86SX3-6; Sequence=VSP_033066;
CC   -!- SEQUENCE CAUTION:
CC       Sequence=CAD62351.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};
CC       Sequence=CAD62363.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};
CC       Sequence=CAD62611.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};
DR   EMBL; BX161477; CAD61932.1; -; mRNA.
DR   EMBL; BX248038; CAD62351.1; ALT_INIT; mRNA.
DR   EMBL; BX248074; CAD62363.1; ALT_INIT; mRNA.
DR   EMBL; BX248283; CAD62611.1; ALT_INIT; mRNA.
DR   EMBL; AL928654; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471061; EAW81929.1; -; Genomic_DNA.
DR   EMBL; BC016028; AAH16028.1; -; mRNA.
DR   EMBL; AK024506; BAB15796.1; -; mRNA.
DR   CCDS; CCDS45180.1; -. [Q86SX3-5]
DR   CCDS; CCDS45181.1; -. [Q86SX3-6]
DR   CCDS; CCDS45182.1; -. [Q86SX3-2]
DR   CCDS; CCDS55955.1; -. [Q86SX3-3]
DR   RefSeq; NP_001128347.1; NM_001134875.1. [Q86SX3-6]
DR   RefSeq; NP_001128348.1; NM_001134876.1. [Q86SX3-2]
DR   RefSeq; NP_001128349.1; NM_001134877.1. [Q86SX3-5]
DR   RefSeq; NP_001185912.1; NM_001198983.1. [Q86SX3-3]
DR   SMR; Q86SX3; -.
DR   BioGRID; 129629; 27.
DR   DIP; DIP-62062N; -.
DR   IntAct; Q86SX3; 21.
DR   STRING; 9606.ENSP00000376307; -.
DR   iPTMnet; Q86SX3; -.
DR   PhosphoSitePlus; Q86SX3; -.
DR   BioMuta; TEDC1; -.
DR   DMDM; 187470846; -.
DR   EPD; Q86SX3; -.
DR   jPOST; Q86SX3; -.
DR   MassIVE; Q86SX3; -.
DR   MaxQB; Q86SX3; -.
DR   PaxDb; Q86SX3; -.
DR   PeptideAtlas; Q86SX3; -.
DR   PRIDE; Q86SX3; -.
DR   ProteomicsDB; 19061; -.
DR   ProteomicsDB; 6174; -.
DR   ProteomicsDB; 69642; -. [Q86SX3-1]
DR   ProteomicsDB; 69643; -. [Q86SX3-2]
DR   ProteomicsDB; 69644; -. [Q86SX3-3]
DR   ProteomicsDB; 69645; -. [Q86SX3-4]
DR   Antibodypedia; 48308; 51 antibodies.
DR   DNASU; 283643; -.
DR   Ensembl; ENST00000329886; ENSP00000333010; ENSG00000185347. [Q86SX3-3]
DR   Ensembl; ENST00000334656; ENSP00000333959; ENSG00000185347. [Q86SX3-4]
DR   Ensembl; ENST00000354560; ENSP00000346568; ENSG00000185347. [Q86SX3-2]
DR   Ensembl; ENST00000392522; ENSP00000376307; ENSG00000185347. [Q86SX3-6]
DR   Ensembl; ENST00000392523; ENSP00000376308; ENSG00000185347. [Q86SX3-1]
DR   Ensembl; ENST00000392527; ENSP00000376312; ENSG00000185347. [Q86SX3-5]
DR   Ensembl; ENST00000450383; ENSP00000391436; ENSG00000185347. [Q86SX3-4]
DR   GeneID; 283643; -.
DR   KEGG; hsa:283643; -.
DR   UCSC; uc001yrj.4; human. [Q86SX3-1]
DR   CTD; 283643; -.
DR   EuPathDB; HostDB:ENSG00000185347.17; -.
DR   GeneCards; TEDC1; -.
DR   HGNC; HGNC:20127; TEDC1.
DR   HPA; ENSG00000185347; Low tissue specificity.
DR   neXtProt; NX_Q86SX3; -.
DR   OpenTargets; ENSG00000185347; -.
DR   PharmGKB; PA134885988; -.
DR   eggNOG; ENOG410IWUX; Eukaryota.
DR   eggNOG; ENOG4111XJF; LUCA.
DR   GeneTree; ENSGT00390000011474; -.
DR   HOGENOM; CLU_052124_0_0_1; -.
DR   InParanoid; Q86SX3; -.
DR   OMA; SCTPGMG; -.
DR   OrthoDB; 1248596at2759; -.
DR   PhylomeDB; Q86SX3; -.
DR   TreeFam; TF330945; -.
DR   BioGRID-ORCS; 283643; 325 hits in 790 CRISPR screens.
DR   GenomeRNAi; 283643; -.
DR   Pharos; Q86SX3; Tdark.
DR   PRO; PR:Q86SX3; -.
DR   Proteomes; UP000005640; Chromosome 14.
DR   RNAct; Q86SX3; protein.
DR   Bgee; ENSG00000185347; Expressed in tendon of biceps brachii and 127 other tissues.
DR   ExpressionAtlas; Q86SX3; baseline and differential.
DR   Genevisible; Q86SX3; HS.
DR   GO; GO:0005814; C:centriole; ISS:UniProtKB.
DR   GO; GO:0005929; C:cilium; ISS:UniProtKB.
DR   GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-KW.
DR   GO; GO:0045880; P:positive regulation of smoothened signaling pathway; ISS:UniProtKB.
DR   InterPro; IPR027996; DUF4509.
DR   InterPro; IPR028100; DUF4510.
DR   Pfam; PF14970; DUF4509; 1.
DR   Pfam; PF14971; DUF4510; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; Cell projection; Coiled coil; Cytoplasm;
KW   Cytoskeleton; Reference proteome.
FT   CHAIN           1..495
FT                   /note="Tubulin epsilon and delta complex protein 1"
FT                   /id="PRO_0000330692"
FT   COILED          355..387
FT                   /evidence="ECO:0000255"
FT   COILED          452..480
FT                   /evidence="ECO:0000255"
FT   VAR_SEQ         1..126
FT                   /note="Missing (in isoform 4)"
FT                   /evidence="ECO:0000303|PubMed:15489334"
FT                   /id="VSP_033062"
FT   VAR_SEQ         1..49
FT                   /note="MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEA ->
FT                   MSGQRGDWVQ (in isoform 3)"
FT                   /evidence="ECO:0000303|Ref.1"
FT                   /id="VSP_033063"
FT   VAR_SEQ         1..49
FT                   /note="MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEA ->
FT                   MSGQRGDW (in isoform 5)"
FT                   /evidence="ECO:0000303|Ref.1"
FT                   /id="VSP_045690"
FT   VAR_SEQ         144..195
FT                   /note="Missing (in isoform 4)"
FT                   /evidence="ECO:0000303|PubMed:15489334"
FT                   /id="VSP_033064"
FT   VAR_SEQ         196..297
FT                   /note="Missing (in isoform 2, isoform 3 and isoform 5)"
FT                   /evidence="ECO:0000303|Ref.1"
FT                   /id="VSP_033065"
FT   VAR_SEQ         229..297
FT                   /note="Missing (in isoform 4 and isoform 6)"
FT                   /evidence="ECO:0000303|PubMed:15489334"
FT                   /id="VSP_033066"
SQ   SEQUENCE   495 AA;  54231 MW;  3E34FACE82E0EACF CRC64;
     MGRRRQRVDP AAGARAGALP EAIAALSRSL PSGPSPEIFR RAKFDRPEAT SALWQLLFRV
     LSPLPAGNAL ASLALEVQAR LVKSALCSQG YPRLALAQLP EDGSQGSREL LLALSWLLAR
     GPVPEQMLAQ ARVPLGDEMT VCQCEALASP GPPAPHMEAE GPVDVRHVQW LMGKLRFRWR
     QLVSSQQEQC ALLSKIHLYT RGCHSDQSLS HLSVTEAEML RDPEGGQQVS GAGAAQNLDL
     AYPKCLHSFC TPGMGPRTFW NDLWLVCEQP GLLPGDWAAP LDPGGASACS LLSPFRALLR
     TLERENQRLE AVLAWRRSEL VFWRWMDTVL GTCAPEVPAA ASQPTFLPWV PERGGGELDL
     VVRELQALEE ELREAAERRR AAWEAKAGGC GRGPEWSAAR RASREAVEKE LGALQQCWER
     DGGPAQPHGP HRLVRREDGA AGDRDLRAAV VIRTLRSQEA CLEAVLRRLQ GQCRQELARL
     VGARPGLIWI PPPGR
//
DBGET integrated database retrieval system