KEGG   Ureaplasma parvum serovar 3 ATCC 27815: UPA3_0188Help
Entry
UPA3_0188         CDS       T00680                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
upa  Ureaplasma parvum serovar 3 ATCC 27815
Pathway
upa00010  Glycolysis / Gluconeogenesis
upa00051  Fructose and mannose metabolism
upa01100  Metabolic pathways
upa01110  Biosynthesis of secondary metabolites
upa01120  Microbial metabolism in diverse environments
upa01130  Biosynthesis of antibiotics
upa01200  Carbon metabolism
upa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:upa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UPA3_0188 (tpiA)
   00051 Fructose and mannose metabolism
    UPA3_0188 (tpiA)
   00562 Inositol phosphate metabolism
    UPA3_0188 (tpiA)
Enzymes [BR:upa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UPA3_0188 (tpiA)
Exosome [BR:upa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UPA3_0188 (tpiA)
  Exosomal proteins of bladder cancer cells
   UPA3_0188 (tpiA)
  Exosomal proteins of melanoma cells
   UPA3_0188 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACA32814
UniProt: B1AIG9
Position
218563..219279
Genome map
AA seq 238 aa AA seqDB search
MKYIIANFKMNATQELINHFLNNLTLFDEQKIIIGLAPGDLYLKTFVNLAEIKKVNLYAQ
NPSLHNKGPYTGQISCLQLLDINIKNALVGHSEIRIDFSQSIIDQKIKISMDLLEQVIIC
VGETFDAYKQNKSLNFVLNQLANIINYKGLKKIIIAYEPIWAIGTDLELDFKHINYMIEG
IKTYLYNCTGINIPILYGGSVNDNNINELCNQKLIDGFLIGNASLDVNVFNKIIDKCK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattattgctaattttaaaatgaatgcaacacaagaattaattaatcatttt
ttaaataatttaacgttatttgatgagcaaaaaattattattggtttagcaccaggggat
ttatatttaaaaacatttgttaatttagctgaaataaaaaaagtcaatttatatgctcaa
aacccatcattacataataaaggaccttatacaggtcaaataagttgtttacaattatta
gatattaatattaaaaatgctttagttgggcatagtgaaatacgtattgatttttcacaa
tcaataattgatcaaaaaataaaaatatctatggatttattagaacaagtcatcatttgt
gttggcgaaacttttgatgcttataaacaaaataaatcacttaattttgttttaaatcaa
ttagccaacatcattaattacaaaggattaaaaaaaattattatcgcttatgaaccaatt
tgagcaattggcactgatttagaattagattttaaacatattaattacatgatcgaagga
attaaaacatatttatataattgtactggaataaatattcctattttatatggcggtagt
gttaatgacaataatattaatgaattgtgcaatcaaaaattaatcgatggttttttaatt
ggcaatgcttcattagatgttaatgtttttaataaaattatcgataaatgtaaataa

DBGET integrated database retrieval system