KEGG   Ureaplasma parvum serovar 3 ATCC 27815: UPA3_0192Help
Entry
UPA3_0192         CDS       T00680                                 

Definition
(GenBank) phosphofructokinase family protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
upa  Ureaplasma parvum serovar 3 ATCC 27815
Pathway
upa00010  Glycolysis / Gluconeogenesis
upa00030  Pentose phosphate pathway
upa00051  Fructose and mannose metabolism
upa00680  Methane metabolism
upa01100  Metabolic pathways
upa01110  Biosynthesis of secondary metabolites
upa01120  Microbial metabolism in diverse environments
upa01130  Biosynthesis of antibiotics
upa01200  Carbon metabolism
upa01230  Biosynthesis of amino acids
upa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:upa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UPA3_0192
   00030 Pentose phosphate pathway
    UPA3_0192
   00051 Fructose and mannose metabolism
    UPA3_0192
   00052 Galactose metabolism
    UPA3_0192
  Energy metabolism
   00680 Methane metabolism
    UPA3_0192
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    UPA3_0192
Enzymes [BR:upa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UPA3_0192
Protein phosphatases and associated proteins [BR:upa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UPA3_0192
Messenger RNA biogenesis [BR:upa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     UPA3_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Spatacsin_C
Motif
Other DBs
NCBI-ProteinID: ACA33041
UniProt: A0A2C9DYL8
Position
223120..224085
Genome map
AA seq 321 aa AA seqDB search
MNQVNFLNLDKNILIITSGGDAPGMNASLISLIHRLMNNNFNVFIGIEGLLGLYNNLIEP
IKDKRVFDVYFNEQGTVIKTSRFIKLDINDKKTQIIKDNLLSHNIQKIIILGGQGSMQAG
LVLTKMGFEVFGILHTIDNDFSETQMCIGALSAASFNQKLLKCLNYTAKAHCAFNLVELM
GRECSWLVNNSVGKLKPILMLTNQDNKYTVDEVIDLIKDKINSIKEYDPLIIVQELIYDQ
KWYELLVKTFEQKLHKSLRITILNYLQRGAPVSDFDLQLAKDSANVLVDFIVNQNDIKNT
NNMYVVINKFDNKLEVIKFNK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagtaaattttttaaatttagataaaaatattttaattattacttcaggtggt
gatgcaccgggtatgaatgcttcattaatttcattaatccatagattaatgaataataat
tttaatgtttttataggaattgaaggattattaggactgtacaataatttaattgaacca
attaaagataaacgtgtttttgatgtttattttaacgagcaaggaacagtcattaagaca
agtagatttattaaattagatattaatgataaaaaaacacaaattattaaagataattta
ttaagtcataatattcaaaaaattattatcttaggcggccaaggtagtatgcaagctggt
ttagtgttaacaaaaatgggctttgaagtctttggaatattacacactattgataatgat
tttagtgaaacacaaatgtgtataggggccttaagtgctgcttcttttaatcaaaaatta
ttaaagtgcctaaattacacagcaaaagctcattgtgcttttaatttagttgagcttatg
ggtcgtgaatgttcatgattagtcaataatagtgttggtaaattaaaacctattttaatg
ttaactaatcaagataataaatatactgttgatgaagtaatagatttaattaaagataaa
ataaactcaataaaagaatacgatcctttaatcattgttcaagaattaatctatgatcaa
aaatgatacgaattattagtaaaaacttttgagcaaaaattacataaaagtttacgaatt
acaattttaaattatttacaacgcggagctccagtaagtgattttgatttacaattagca
aaagatagtgcgaatgtattggttgattttattgttaatcaaaatgatataaaaaacaca
aataatatgtatgtagttattaataagtttgataataagttagaagttattaaattcaat
aaatag

DBGET integrated database retrieval system