KEGG   Ureaplasma parvum serovar 3 SV3F4: UP3_c0500Help
Entry
UP3_c0500         CDS       T03673                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
upr  Ureaplasma parvum serovar 3 SV3F4
Pathway
upr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:upr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    UP3_c0500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:upr03011]
    UP3_c0500
Ribosome [BR:upr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    UP3_c0500
  Bacteria
    UP3_c0500
  Archaea
    UP3_c0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF365
Motif
Other DBs
NCBI-ProteinID: BAO73807
Position
complement(646474..647409)
Genome map
AA seq 311 aa AA seqDB search
MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAPIVLKLLNSAISNVQH
NSKDMDPSKLYIYKIVANQGPTMKRTLPRAKGSADQLFKRTTHLEIVLSDDVNEREKELA
AIKAKKSKKPLAVEPIAKVETKKVAKPSKVEIKPVEKDENVDPELLKREQQVLKVVEKTA
SQKEEKTTETIMISTSPKNAQVLFDDLEKNVIFYKTTPINKVLRVLVYVTSPTKKVVGEF
DLESVEIGAISSIWRKYSKQSVISKKEYDAYYEGKDKAHALVSKKAYKYRNPKDLSEYNM
TKGPSGFQYLK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaagttattcaaagaaatattcatatttcgcaccgtaaagcttctcttgta
attgatttagttcgaaacaagccagtacatgaagcaattcgaattttaagtaatacacca
aagaagtttgctccaatcgttttgaaattacttaactcagcaatttcaaacgttcaacat
aactctaaagatatggatccaagtaaactatatatttacaaaattgtagctaatcaaggt
ccaacaatgaaaagaacactaccacgtgctaagggttctgctgatcaattatttaaacgt
acaacacatttagaaattgttttatctgatgatgttaatgaacgtgaaaaagaattagca
gctattaaagctaaaaaatcaaaaaaaccattagcagttgaaccgattgctaaagttgaa
actaaaaaagttgctaaaccaagcaaagtagaaataaaaccagttgaaaaagacgaaaac
gttgatccagaacttttaaaacgtgaacaacaagttttaaaagttgttgaaaaaactgct
tcacaaaaagaagaaaaaactactgaaacaattatgatttcaacatcacctaagaatgca
caagttttatttgatgatttagaaaaaaatgtaatcttttataaaacaacacctattaat
aaagttttacgtgtactagtttatgtaactagcccaactaaaaaagttgttggtgaattt
gatttagaatcagttgaaattggtgcaatttcatcaatttgaagaaaatacagcaaacaa
tctgtaatttctaaaaaagaatatgatgcttactatgaaggaaaagataaagcacatgca
cttgtaagcaaaaaagcatataaataccgtaatccaaaagatcttagcgaatataacatg
actaaaggtccaagtggattccaatatttaaaatag

DBGET integrated database retrieval system