KEGG   Undibacterium parvum: EJN92_01215Help
Entry
EJN92_01215       CDS       T05754                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
upv  Undibacterium parvum
Brite
KEGG Orthology (KO) [BR:upv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EJN92_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AZP10767
UniProt: A0A3Q9BN48
Position
complement(273140..274150)
Genome map
AA seq 336 aa AA seqDB search
MQTLHISMYVIVFLVVLALLFDFMNGFHDAANAIATVVSTGVLKPQQAVAMAAFFNVLAI
VVFPLTVATTIGKGTIDPAIVDHYVIFGALVGATFWNFVTWYFGIPSSSSHALIGGMVGA
AVAKSGTGALISAGLYKTIIFIVISPLLGFFLGSLMMLIVSWLFVKSTPMKVDKWFRRLQ
LVSASMFSLGHGGNDAQKTMGIIWMLLISAGYSSQADKMPPLWVIISCYAAIGLGTLFGG
WRIVKTMGQKITKLKPVGGFCAETGGAITLFMATALGIPVSTTHTVTGAIVGVGSAQKMS
AVRWGVAGNIVWAWFLTIPASAFVAAIAWWLGTKIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccctccatataagcatgtatgtcatcgtatttctggtggtattggctttgtta
tttgattttatgaatggcttccacgatgcggcaaacgcgattgccaccgtggtttctacc
ggcgtactcaagccgcaacaagcggtggcgatggccgcctttttcaatgtgctcgcgatc
gtggtgtttcctttgacggtagcgaccaccatcggtaagggcaccatagacccggcaatt
gttgatcactacgtgatttttggggccttggtgggcgccacgttttggaattttgttacc
tggtactttggcataccttcttcctcatcacacgccttgataggtggcatggtcggcgca
gctgttgctaaatcgggcactggtgccttgatttctgccggactttacaaaaccatcatc
ttcatcgtgatttcgccattgctgggatttttcctgggatccttgatgatgttaatcgta
tcctggttatttgtgaaatctacccctatgaaggtcgataagtggtttcgtcgcctgcaa
ctggtgtcggcttcgatgtttagtctcggtcatggtggtaacgatgcgcaaaaaaccatg
ggcataatctggatgttattgatctcggcgggctactctagccaggctgataaaatgcca
ccgctatgggtgattatttcttgttatgcagcgatcggtctgggcaccttgtttggtggc
tggcgtatcgtcaaaaccatggggcagaagatcactaaacttaaaccggtgggcggcttt
tgtgctgaaaccggtggtgctatcactctgtttatggcaactgctttaggcattccggtg
tcgaccactcacactgtgactggtgcgattgtcggcgtaggatctgctcagaaaatgtcg
gcagtgcgctggggtgtggctggtaacattgtatgggcctggttcttgaccatccctgct
tcagcctttgtcgccgccattgcatggtggttgggaaccaagattttgtaa

DBGET integrated database retrieval system