KEGG   Undibacterium parvum: EJN92_02615Help
Entry
EJN92_02615       CDS       T05754                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
upv  Undibacterium parvum
Pathway
upv00450  Selenocompound metabolism
upv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:upv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EJN92_02615 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:upv03016]
    EJN92_02615 (selD)
Enzymes [BR:upv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     EJN92_02615 (selD)
Transfer RNA biogenesis [BR:upv03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    EJN92_02615 (selD)
 Prokaryotic type
    EJN92_02615 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AZP11004
UniProt: A0A3Q9BPD5
Position
complement(587719..588771)
Genome map
AA seq 350 aa AA seqDB search
MNTNETPIRLTSFSHGGGCGCKIAPGVLAEILKKSTGFPVPAALMVGIETSDDAAVYKLN
DEQALIATTDFFMPIVDDPYDFGRIAATNAISDVYAMGGTPIMALALVGMPINQLPLEVI
GQVIQGGESICAQAGIPIAGGHTIDSVEPIYGLVVLGLIHPTKLKRNSDAKVGDKLILGK
PIGVGILSAALKKQALDDAGYASMIANTTKLNKPGQALSALDGVSAMTDVTGFGLLGHLL
EVCRGAQVGARLNMSTIPLLPQVAQLAEAGYITGASARNWEAYGKDVKLNGVSAVQQALL
SDPQTSGGLLVACDAGSVERVLEIFRSGDFLDASVIGDIVAGTSIVEVNP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgaatgaaactccgataaggctgacttctttctcgcacggtggtggctgcggt
tgcaaaattgcgcccggtgtactggccgagatattaaaaaaatcgaccggctttccggtg
cctgcggccttaatggttggtattgaaacctctgacgatgccgcagtatataaactcaac
gacgagcaggcgctgattgcgactactgatttttttatgcctatcgtcgatgatccttat
gattttggccgaatagctgcaaccaatgcgatttctgacgtctatgcgatgggcggcaca
cctatcatggccttggctttagtgggcatgccaattaaccagttgccgttagaggtgatt
gggcaagtgatccagggcggtgagagtatttgcgcgcaagcgggtatcccaatagcaggt
ggacatacgatagattcagtagaaccaatttacggtttggtggtattgggcttaattcac
cctactaaactcaagcgcaattccgatgccaaagtgggtgacaagctcatacttggcaag
cctatcggcgttggcatcttgtcggcggcgctgaaaaaacaagccttagatgatgccgga
tatgccagcatgattgcgaatacgactaagttgaataagccagggcaagcactgtccgcc
ttggatggggtgagtgccatgaccgatgttactggattcggtttgcttggacacctgttg
gaagtgtgtcgtggcgcgcaagttggtgcgcgcttgaacatgtcaacgatccctttattg
ccacaagtggcgcaactggctgaggccggttatatcacgggcgcatcggcacgaaattgg
gaggcttacggtaaggacgtcaaacttaatggagtaagtgctgtacagcaagctttgttg
agtgatccgcaaacctcgggtggcttattagtagcctgtgatgctggctcggtagagcgg
gttttagaaatatttagaagcggtgattttttggatgcatccgtaataggtgatattgtt
gcgggaacaagtatagtagaagtaaacccttga

DBGET integrated database retrieval system