KEGG   Undibacterium parvum: EJN92_06790Help
Entry
EJN92_06790       CDS       T05754                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
upv  Undibacterium parvum
Pathway
upv00520  Amino sugar and nucleotide sugar metabolism
upv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:upv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EJN92_06790
Enzymes [BR:upv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     EJN92_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short KR NAD_binding_10 NmrA
Motif
Other DBs
NCBI-ProteinID: AZP11727
UniProt: A0A3S9HHY0
Position
1575545..1576480
Genome map
AA seq 311 aa AA seqDB search
MKKILVTGGAGFLGSHLCEKLLNQGHTVICLDNFFTGREENIEHLRSNPSFQVIRHDVSL
PLPEIKVDEIYNLACPASPPRYQLDPIQTMKTSVLGALNLLEMARLQNAKIFQASTSEVY
GDPSVHPQPESYWGNVNTIGIRSCYDEGKRAAETLFFDYHRQHGVRIKVVRIFNTYGPRM
DPNDGRVVSNFIIQALRGQDLSIYGDGSQTRSFCYVDDLIEGFIRFMNADDAITGPLNLG
NPCEFTMLELTEKVLALTGTSSKLSFKPLPQDDPKQRQPDLTATKQQLDWQPTIELEEGL
RHTIEYFRKHA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattcttgtaacaggtggcgcgggttttttgggctcacacctatgtgaaaaa
cttttaaaccaaggtcatacggtaatttgccttgataatttttttacaggcagagaagaa
aatattgaacacttacgttcaaatccaagctttcaagtaatccggcacgacgtatctttg
ccattacccgaaataaaggttgatgagatttacaacttagcgtgcccagcatcgccgccg
cgatatcaactcgatcctattcagacgatgaaaacgtcggtattgggagcactcaatcta
ctcgaaatggcgcgtttgcaaaacgctaaaattttccaggcatccacttcagaagtgtat
ggcgacccatcagtacacccccagcctgaaagttattggggcaacgtcaataccataggc
atacgtagttgttatgacgaaggaaaacgtgccgcagagactttattttttgactaccac
cgtcagcatggtgtgcgtatcaaagtcgtgcgcatttttaatacttatggcccacgcatg
gaccccaacgatggtcgcgtagtaagtaacttcatcatccaggctttacgtggacaagac
ttaagcatttacggagatggttcacaaacacgcagtttctgctatgttgatgacctcatc
gaaggcttcatccgtttcatgaacgctgatgatgcaatcacaggtccgctcaatttaggt
aacccttgtgaattcaccatgttagaacttacagaaaaagtactagcacttacagggact
agcagtaaattaagctttaaacctttacctcaggatgacccaaaacaacgtcagcctgac
cttacagcaacaaaacagcaactcgattggcaaccgactatcgaattagaagaggggctg
cggcacactatagaatattttcggaaacacgcgtaa

DBGET integrated database retrieval system