KEGG   Undibacterium parvum: EJN92_12765Help
Entry
EJN92_12765       CDS       T05754                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
upv  Undibacterium parvum
Pathway
upv00471  D-Glutamine and D-glutamate metabolism
upv00550  Peptidoglycan biosynthesis
upv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:upv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EJN92_12765
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EJN92_12765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:upv01011]
    EJN92_12765
Enzymes [BR:upv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     EJN92_12765
Peptidoglycan biosynthesis and degradation proteins [BR:upv01011]
 Precursor biosynthesis
  Amino acid ligase
   EJN92_12765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AZP12796
UniProt: A0A3S9HL25
Position
2919560..2921071
Genome map
AA seq 503 aa AA seqDB search
MEFSGKHVLVLGLGESGLAMSRWLLRCGAKLRVADTRIAPDRLAILRSLSSEIEFIGADF
SVDLLNGIDLVAVSPGLSPLNELAILLPEIQKNNIPFWGEVEIFAHALLALKSTHGYQPK
LIAITGTNGKTTVTNLVGLLCERAGLSVKLAGNISPAMLDVLCEAIDADALPQVWVLELS
SFQLHTSYSLEADVATVLNISQDHLDWHGNLKSYCADKARIFGTKTTQVLNRDDALVMAM
QISNPQSENKRVTFGIHAPLADGDVGLLNEHGMIWLAAANSAEEEQAASRRKKKNLEEVP
IIISRLMPADALKIRGQHNAANALAALALCRAIGLPLAPLLHGLREYTGEPHRVELVANI
AGVDFIDDSKGTNVGATVAALNGLGAESHAKGKRIILIAGGEGKGQDFSPLTAPLTRYAK
VIFLIGKAAAEMRQTFQECQIELRDFSTLEQAVWAAAEIAQEGDIVLLSPACASLDMFRN
YAHRAQVFVDTVREVALARGEIA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaggtaaacatgtattggtacttggtctcggcgagtcggggctggcgatg
tcgcgttggttgctgcgctgcggtgccaagctgcgtgtggccgatacacgtatagcgcct
gatcgattagcgatacttagatccctgtcttcggaaatcgaattcatcggcgccgatttt
tcggtagacttgttaaacggtatcgatctagtcgcggtgagcccaggattgtcacctttg
aacgagctggcaattttattgccggaaatacagaaaaataatattccgttttggggtgaa
gttgaaatttttgcgcacgccttgctcgcattgaagtctacacacggataccaaccgaag
ctaattgcgattactggcaccaatggcaaaactaccgtaactaacttggttggtttgctg
tgcgaacgtgctggtttaagcgttaagcttgccgggaatattagccccgcgatgctcgat
gtattgtgtgaagcgatcgatgccgacgcacttcctcaagtgtgggtgttggaattgtct
agttttcaattgcataccagttatagcctagaggcggatgttgcgactgttttgaatatt
agccaagatcatctggactggcacggcaatttgaaatcatattgtgctgataaggcgcgc
atattcggaaccaaaaccacacaagtattaaaccgtgacgatgccctggtcatggcgatg
cagatctcaaatccacagtctgaaaataaacgggtgactttcggtattcacgcgcctttg
gccgacggtgacgtaggcttgctgaacgaacacggcatgatctggttggccgctgcgaat
agcgcggaagaagagcaggctgcaagccgtagaaaaaagaaaaatctagaagaagtccct
atcattatctcgcgcttgatgccggccgatgcgcttaaaattcgagggcaacacaatgcc
gccaatgccttggccgcattagcactttgccgtgccataggcttgcccttggcgccactt
ttgcatggcctgcgcgaatataccggcgaaccacatcgggttgagctggtcgctaacatc
gctggagtcgattttatcgacgacagtaaaggcactaatgtaggcgccacggttgccgca
ttaaacggcctaggtgctgaatcacatgccaagggcaaacgtatcattttaatcgccggt
ggtgaaggcaagggacaggatttctctcccttaactgcgcccttgacgcgctatgcaaag
gttattttcttgataggaaaggctgcggctgagatgcgtcagacctttcaagaatgtcag
atagagttacgagatttttctactttagagcaggccgtatgggccgctgcggagatagcg
caagagggcgatatcgtcctgctttcaccggcttgtgccagccttgatatgttccgaaat
tatgcgcacagagcacaggtttttgtcgatacggttcgtgaagtagcgctggcacgtgga
gaaatcgcttaa

DBGET integrated database retrieval system