KEGG   Undibacterium parvum: EJN92_13855Help
Entry
EJN92_13855       CDS       T05754                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
upv  Undibacterium parvum
Pathway
upv00220  Arginine biosynthesis
upv00330  Arginine and proline metabolism
upv01100  Metabolic pathways
upv01110  Biosynthesis of secondary metabolites
upv01130  Biosynthesis of antibiotics
upv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:upv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EJN92_13855 (rocF)
   00330 Arginine and proline metabolism
    EJN92_13855 (rocF)
Enzymes [BR:upv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     EJN92_13855 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AZP12989
UniProt: A0A3Q9BRX1
Position
complement(3166443..3167360)
Genome map
AA seq 305 aa AA seqDB search
MKTISLIGAPTDVGASVRGAGMGPDALRVAGLVEALEARSLTVIDHGNLHGPANPWLEPV
NGLRHLKEAIDWNQAVYNAVEAALAAGQMPMMLGGDHCLAIGSISAIANHCRKVGKKLRV
LWFDAHADSNLSTISPTGNIHGMPVACLMGHGPKELISYGAHTPAMLPSEIRLIGIRSVD
EGERRFIHEMGMQVFDMRYIDEHGMRAVMTSALEGIDADTHLHVSFDLDCLDPAIAPGVG
TAVLGGPTYREAQLCMEMIADTGMLASLDVVELNPALDLRNQTAVLAVDLIESLFGKSTL
VRLKD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatttccttaattggagcgcctaccgatgtgggcgcaagtgtcagaggcgcg
ggcatgggcccggacgcattacgtgtagctggcttggtcgaggcgctagaagcgcgctct
ttgacggtcatcgatcacggcaatttacacggccccgctaacccttggctggaaccggta
aatggcttgcgtcatctgaaagaagccatagactggaaccaagcggtgtataacgccgtg
gaagccgccttggcagctggccagatgcctatgatgctgggtggcgatcattgtttagcg
ataggttctatcagtgcgattgccaatcattgccgcaaggtcggcaaaaaactgcgcgtc
ttgtggtttgatgcgcatgccgacagcaatctctcgaccattagccctaccggcaatatc
cacggcatgccagtagcttgtttgatggggcatggcccgaaagagttgatcagttacggt
gcgcacacaccggccatgctgcctagcgagattcgtctgatcggcatccgcagcgtcgat
gaaggcgaacgccgcttcatccacgagatggggatgcaagtgtttgatatgcgttacatc
gacgagcatggcatgcgcgcagtcatgacttccgctttggaaggtatcgatgccgacacc
catttgcacgtcagttttgatctcgattgcctcgatcctgcgattgcgcctggcgtaggt
accgcagtattgggcggcccgacttaccgtgaagcacagctctgcatggaaatgatcgcc
gacaccggtatgcttgcgtccttagacgtggtcgaacttaatccggcactcgatttacgc
aatcagactgcggtgttagcggtagatttgatagaaagtctgttcggcaaatcgaccctg
gtcaggctgaaagactaa

DBGET integrated database retrieval system