KEGG   Undibacterium parvum: EJN92_19335Help
Entry
EJN92_19335       CDS       T05754                                 

Gene name
recC
Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
upv  Undibacterium parvum
Pathway
upv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:upv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EJN92_19335 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:upv03400]
    EJN92_19335 (recC)
Enzymes [BR:upv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EJN92_19335 (recC)
DNA repair and recombination proteins [BR:upv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EJN92_19335 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AZP13957
UniProt: A0A3S5HM47
Position
complement(4428529..4432017)
Genome map
AA seq 1162 aa AA seqDB search
MSVPISTITPGLIILHGNQLEQLRAAVFAWLRLHPLAPLEQALFLVQSNGIAEWLKIAVA
EELGVCAATRIDLPGRFLWGVYRAMLGRDQVPSRSALDKAPLTWRLMRLIPELLEQDDFL
PLRHFLADGNPERRLQLAERLADLLDQYQVYRADWLNDWAEGRDVLRNASGEVKALLPDQ
RWQAQLWRAILTDVVNNSDDAADALGRVTVHQRFLEQVASGQLPVSKLPRRVVLFGISAM
PQQTLEALAALAKHTQVILAVPNPCQFYWGDIIEGRELLKAQHKRQQARKGLDLSTIPLD
QLHAYSHPLLAGWGRMGRDFVRLLDEFDNAKATQENFSSLRIDLFTEEQGSTLLAGLQAS
VRDMLPLNEHPHPGFNADDRSIVFHVAHSTQREVEILHDQLLSMLAEQKTALRPRDIVVM
VPDIEVFSAAIRAVFGQYPQRDARHIPYTIADVKDRSVNPLLLALDYLLRLPQQRCRQSE
VRDLLDVAALATRFGVRPEDLPQLSLWIAGAEIRWGLDQSHREGLGLGATGEQNAWIFGI
RRMLLGYASGNAESYAGIQPYAEIGGLDASLAGSLAQFIESLIHWRAVLAQSATPELWGQ
RARALLRAFFVTEGSQLAEADRLTLGQLEDTLQQWLEACRSAGFEESISLSVMREAWLSA
LDQPSVDHQFVSGGVTFCTLMPMRAVPFKVVCLLGMNDGDYPRRSQHLDFDLLAQAGMAR
PGDRSRRHDDRYLMLEALLAARDTLYISWVGKNIRDNSEQPASVLVAQLRDYLKAAWDCE
LEQMTTQHALQAFSRRYFEQAGLTTYAREWRNAHHEITLGQPIAPDATLSGETLAAFEVD
KGYRLKLSELARFIKQPAKYFFRQRLGVMFNDEQTLGEDEEPFGLNALEEYARADSLLDD
LGKPEAIAEVADTLSKRAAKLGREGVLPVGLIGSQWQNQLVNALTPVRTAWLELCQQYPY
PAEKVAINLIIDEIQLDGWLERMHSSTAGQNGEVVSLTQISSKITNKKGELRGEKLIDAW
LSQLAAAALGRPVMGFLLARDAIISMQPLAQAEAIETLHTLLACWRAGMDRPLPSACKTG
LALAQAGNPQQVYEGGYQLRGEVEEASLARLWPDYAALSSEPDYESCSLTLYGALAAWMQ
SALGITAIDAYLSTSNDDQDAA
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcccaatttctactatcacgcctggtctgattattctgcatggcaatcagctc
gaacaattgcgtgccgcggtgtttgcctggttgcggcttcatccactggcgccattggag
caggcgctatttttggtgcaatcgaacgggattgccgagtggctgaaaatcgccgtggcg
gaagaattgggcgtctgcgctgccacccgcatcgatttgccagggagatttttgtggggc
gtgtatcgagctatgttagggcgcgatcaggtgcccagccgatccgccttagataaagca
ccgctgacctggcgtttgatgcgcctgattcctgagttgctggagcaagatgatttttta
ccgctcaggcactttctagctgacggcaatcccgagcgtcgcctgcaattggccgaacgt
ctggccgatttactcgatcaatatcaggtgtaccgcgccgattggctcaatgactgggcc
gaggggcgcgatgttttgcgcaacgccagtggagaggtaaaagctttattgcctgatcag
cgctggcaggcgcaactgtggcgtgccattctgactgacgttgtcaacaatagcgacgat
gcagccgatgctctgggacgggtgacggtacaccagcgttttcttgagcaagtggcaagc
ggccaactgcccgtcagcaagctaccacggcgggtggtgttatttgggatttcggcgatg
ccgcagcaaactctggaggcgctagcagccttggcaaagcatactcaggtgatcttggca
gtacccaatccttgccagttttattggggcgacatcatagaaggacgcgaactgctcaag
gcccagcacaagcgccagcaagcacgcaaaggcttggacctatcaacgatccccttagat
cagttgcatgcatacagccatcctctgctggcgggatggggccgcatggggcgcgatttt
gtgcgcttgctggatgaattcgacaatgccaaggccacccaagaaaatttcagcagcttg
cgcattgatctgtttaccgaagagcaaggctctactttattagccggcttgcaggcctcg
gtgcgcgatatgctgccgctcaacgagcaccctcaccccggctttaatgccgacgatagg
tctatcgttttccatgttgcgcacagcacgcagcgcgaggtcgaaattttgcatgatcaa
ttattgagcatgctagccgaacaaaaaacagccctgagaccgagggacatcgtggtgatg
gtgcccgatatcgaggtattctcagctgccatccgcgccgtgttcgggcaatacccgcaa
cgcgatgcccgtcatatcccctacaccatcgccgacgtcaaagaccgtagcgtcaacccg
ctattgctggcactcgattatttactgcgcttgccgcagcagcgttgccgccagagtgag
gtgcgtgatctattggatgtcgcggcactggcaacccgatttggcgtgaggccagaagac
ttgccgcaactgagcctgtggatcgccggcgccgagatacgctggggcctggatcaaagc
caccgcgaaggcttggggttaggtgccactggcgagcaaaatgcctggatctttggcata
cgccgtatgttgctcggttacgccagtggcaatgcagaaagttacgccgggatacagccc
tacgccgaaatcggcggcctcgatgcctctctagcgggatcgctggcgcagtttatcgag
agtttgatccattggcgggcagtgttggcgcagtccgccactcccgagctctgggggcaa
cgtgcgcgtgcgctgttacgcgctttctttgtgactgaaggtagccaactcgctgaagct
gatcgcctcactttgggccaattagaagacacgctacagcaatggttagaggcatgccgc
agcgctggttttgaggaaagcattagcctgagcgttatgcgcgaagcttggctaagcgcg
ctcgaccagcctagtgtagaccatcagttcgtctccggcggcgtgactttttgcacactc
atgccgatgcgcgcggtgccgtttaaagtggtgtgtttgctaggcatgaatgatggcgat
tatccgcgtcgcagccagcatcttgattttgatttactggcacaagctggcatggcgcgc
ccgggtgaccgttcgcgccgccacgatgacaggtatctgatgctagaggcgctgctagcc
gcacgcgacactctgtatatctcttgggtaggaaaaaatattcgtgacaatagtgaacag
ccggcctcggtgctggtggcgcaattgcgtgattacctcaaggcagcctgggattgcgag
ctcgaacaaatgacgacccagcatgcgctgcaggcatttagccggcgctactttgagcaa
gctggcttgaccacctacgccagagaatggcgcaatgctcatcatgagatcactttaggt
cagcccatcgcgcccgatgccacattgagcggcgagacattagccgcatttgaagtcgat
aaggggtatcgcctcaagctcagtgagttggcgcgctttatcaagcaaccggcgaaatat
tttttccggcagcgactgggggtgatgttcaatgatgagcaaaccctgggcgaggatgaa
gaacctttcggcctgaatgcgctagaagaatatgcgcgtgccgatagtctattagacgac
ttaggcaagccagaagcgatcgccgaagtggccgacacgctcagtaaacgtgccgccaag
ctggggcgcgaaggcgtattgccggtaggactaatcggtagccaatggcaaaaccagttg
gtgaatgcattgacgccagtacgcactgcctggttagagctgtgccagcaatacccttac
ccagccgagaaagttgcgatcaatctgatcatcgatgagatacagttagacggctggctg
gagcgcatgcacagcagtactgctgggcaaaatggcgaagtggtcagcctgacccagatt
tccagcaagatcacgaataaaaaaggcgaattgcgcggcgagaaattgatagacgcctgg
ctcagtcaattggcagcggcagcattaggacgcccggtgatgggtttcttattagcacgc
gatgccatcatcagcatgcaacctttagcccaagctgaagcaatcgagaccctgcacact
ttgctcgcctgctggcgcgctggcatggatagacccttacctagtgcctgtaaaaccggt
ctggctctggcacaggcaggcaatcctcagcaagtgtacgagggtggttatcaactacgc
ggcgaagtcgaagaggccagcttggccagactatggccagactacgcagcgctcagcagc
gagccagattatgagtcttgctcgctgacactatacggtgctttagccgcatggatgcaa
agcgcgctgggcatcaccgcgatagacgcctacctcagtactagcaacgatgaccaggat
gcagcatga

DBGET integrated database retrieval system