KEGG   Uncinocarpus reesii: UREG_00394Help
Entry
UREG_00394        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K06671  cohesin complex subunit SA-1/2
Organism
ure  Uncinocarpus reesii
Pathway
ure04111  Cell cycle - yeast
ure04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ure00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    UREG_00394
   04113 Meiosis - yeast
    UREG_00394
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ure03036]
    UREG_00394
Chromosome and associated proteins [BR:ure03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Cohesin complex
    UREG_00394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAG HEAT_2
Motif
Other DBs
NCBI-GeneID: 8444477
NCBI-ProteinID: XP_002540881
UniProt: C4JL59
AA seq 1202 aa AA seqDB search
MAEDTRRRQSRRMRRKPEFFSSQTFSSATTKRKRTSSRRDGEDDDASDSGDAGDDVNDEE
VEDAEEEEDDESEGEPDEEELRERRRSTKKAAKRKQPKESNKGPSRAKRATKKPRIANGI
ETNLALRPLVNGEGRKPKKPRKPRVRPSGFAGEEGLYAEVFARGHTTDAVAAEWLTKYEK
HNIHAMRELVNFILRCSGTDLKVDDNDIEDVDNIASRLDDLQEEYQSQSITEYPLISRSK
KFRGFQSVLTRFFESLIKTIHSASVLYNDAALLENIQAWITSMSSAPIRPFRHTATIISL
TIVTTLCYVAKEVSTTLSNTRKQLETEKKKKTVNKGRVGALQSKVQENEQKLEVIDNVLH
DSFDTVFVHRYRDVDPKIRAECMSALGLWMVTYKQLFFEGQYLRYLGWVLSDTVPHTRSI
VVQQLHRLFQNKDNIPGLRAFTERFRPRIVEMAVRDAESSVRAAAVELSDLIRDAGLLEP
DDIDGVGRLVLDSETRVRKAAGKFFVANIQDVYDSQIEGLEEELSESFVDDDEDDDFKIP
RRSWIKYKCLVDMLQAYDEQQSEMTENRELTTKTDLFGNQVESRFALATESIYPHFQDLN
RWESLAGYLLYDHSQIPESAGEDDDAAEAVKQLYKLDEGQEVILLEVLSAAVKLHIQEIS
KSDTDKKGRKTKLLMERMEAKQEAIAHNLSQIIPQLLNKFGAAPEAASAVLRLEHLVNLD
LIQDLQKDAASYAEILNNINKQFLTHSDQNVLAEATVAFLHARTSEELKEAMENKVQELW
DDTLDALCTVVANKRVQETSTLSAGVLSSLKNNVARISNLASIADCTSTLETSAQNSKKR
NSETQPAVDILLDVAKRGLREASFDEEVDSLERELIFNTFRTLLVYFMWKVQALDSGLSN
GKASFNERYFENLSARRESFLSTLTAIMQTRKGVDNTRIAAATTLLDLQTVFGTLRHTVT
NKAQDGDNETLMQVEELVQDISPAASTLISRIHDAVLKAYAKKSHHTIDITTTDEDLPES
QSDLESSSDEEDDEMDDDEDDVQSSARRMRAKLLAEQRLCEFTGKIVLAIIGHVLDSSGS
NAGKLKAKLLRHKSRLGHNYKAVLAYLEEDKAPTAARGVLKSSVKPQRPNGTTANISNGK
FKSTERVVDDEEEEEEEEIRPAEDDEEDDLRSRGPMENDEDHGEREGAESPLTPIEDDIM
GD
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatacacgcagacggcagtccaggcgcatgcggcggaaaccggaattcttt
tcttcgcaaaccttctcttctgcgactacgaagcggaaacgtacaagctcacgccgcgat
ggcgaagacgacgacgcgtcagattcaggcgatgccggcgacgatgtcaacgatgaagag
gttgaggatgcggaagaggaggaagatgatgagagcgaaggtgagcccgatgaagaagag
ctaagggaaaggcgaagatcaaccaagaaggctgcgaaacggaaacagcccaaggagagc
aataagggcccgtcgagggccaaacgtgccaccaaaaaaccgaggatcgcgaacggcatt
gaaacgaatcttgctttacgaccgctggtcaatggtgaaggaagaaagccaaagaagccg
agaaaaccgcgcgttcgaccaagtggatttgctggtgaggaaggattatacgctgaggtt
tttgctcgcggtcatactaccgacgccgttgctgcggagtggcttacaaaatacgagaag
cataatattcatgcgatgcgcgaacttgtaaattttatcctgcgatgttcaggcaccgat
ttgaaagtcgacgacaacgacatcgaagacgtagacaacatcgcgagccgcctggacgat
ttgcaagaggaataccaatcgcagagtattaccgaatacccccttatatcgagatctaaa
aaatttagagggtttcaatccgtactgacccgatttttcgagtcactcatcaaaacaatc
catagtgcttcggtgctgtataacgatgccgcgctgctagaaaatattcaggcttggatt
acttcaatgtcctctgcccctatccgaccattcaggcatactgccacgatcatctccttg
acaatcgttacgacattatgttacgtcgcgaaagaagtctccacgacattgtcgaacacc
cggaagcaactcgaaacggaaaagaagaagaaaacggttaataaaggcagggtgggcgct
ctccagtccaaggttcaagaaaacgaacaaaaactcgaagtgatagataacgttctccat
gactcctttgacaccgtcttcgttcaccggtatcgggatgttgatccaaaaattcgggcg
gaatgtatgtctgcgcttggcctatggatggtcacttataaacagctattcttcgaaggc
cagtatcttcgatatctgggctgggttctctcagacactgttccacacacgcgatcaatc
gttgttcagcaactccatcgtttattccagaacaaggataacataccaggtctcagggcg
ttcacagaacgtttccgtccaaggatcgtggaaatggctgtgagagatgccgaaagcagc
gttagagcagctgctgtggaattatcagacctgatccgcgacgccggattattggagccc
gacgacattgacggcgttgggagacttgtcttggatagcgagacgcgggtgcgaaaagcg
gctggcaaatttttcgttgcaaatattcaagacgtctacgactcacaaatagaaggcctg
gaagaagaactcagcgaatcgtttgtagatgacgacgaagatgacgatttcaagatcccc
agacgctcttggatcaaatacaagtgcttggtagacatgcttcaagcctacgacgagcaa
caatcggaaatgaccgaaaatcgcgagctcacaacgaaaaccgatttatttggcaatcaa
gtggaatccagatttgcacttgcaacagaaagtatctatcctcatttccaggacctgaac
cggtgggaatctctggccggatatttgctctatgaccattctcagataccagagtcagca
ggtgaagatgatgacgccgccgaagctgtaaagcagctatataaacttgacgaaggtcag
gaagttattctgctagaagtactaagtgctgcggtcaaacttcacattcaagagatatcc
aaatccgataccgacaagaagggcaggaaaacaaagctgctgatggagaggatggaagcc
aagcaagaagctatcgcccataacctctcgcaaataattcctcagctgctaaacaaattt
ggtgccgcaccagaggctgcatcggcagttttaagactcgagcaccttgtcaacctcgac
ctgattcaggaccttcaaaaagacgctgcatcgtatgctgaaatcttaaacaatatcaat
aaacaattcttgacacactctgaccaaaatgtgctggctgaagcgacggtcgccttcctc
catgctcgaacatctgaggagctcaaggaagcaatggaaaataaagtgcaagagttgtgg
gatgatacgctggatgcgctgtgcacggttgttgcaaataaacgtgttcaagagactagc
acactttctgctggagtcctctcttcactcaagaacaatgtcgcccggatctcaaatctg
gccagtatagctgattgtacgtcgacgctcgaaacgtcggcgcagaattccaaaaagcgg
aattctgaaacccaaccagccgtggatatattattggacgtagctaaacgggggctacgc
gaggcgagttttgatgaagaggtcgattccctggagcgagaattgattttcaacactttt
aggactttacttgtttatttcatgtggaaagttcaggcattggattctggtctatcaaac
ggaaaggcatctttcaatgaacgatattttgagaacctatcggcacgcagagaatcattt
ctttccacccttacggctattatgcaaacgcggaaaggggtagacaatacaaggatcgca
gccgctacgactttgttagatttgcagactgtatttggcactctccgacatacagtgaca
aacaaggcccaggacggcgacaatgaaactcttatgcaagtcgaagaattagtgcaagat
atttccccggcagcgtctacattaatatctcgcatccacgatgctgtattgaaagcatac
gctaagaaatctcatcacacgattgacataacgacaaccgatgaagacttgcccgagtct
cagtctgatcttgaatctagctcggacgaggaggatgatgaaatggatgatgacgaggat
gatgtacagtcgagtgcgcgtcgcatgcgtgccaagctcctagctgagcaaaggctctgc
gagttcacaggcaagattgtcctagcgattattggtcatgtattggattcgtcgggctcg
aatgcgggtaaactaaaagcgaaattactccgccataaatcgcgactaggccataactat
aaagccgttctggcatatctagaggaggacaaagcgccaactgcagctcgaggtgtcctg
aaatcctcggtcaaaccgcaacggccgaacggtactactgcgaatatcagcaatggcaag
ttcaaatctactgaaagagtggttgatgatgaggaggaagaggaagaagaggaaattcga
cccgcggaggatgacgaagaggacgatttgcgctctagagggcccatggagaatgacgag
gatcatggcgagcgcgaaggcgcggagtcaccactgacccctatcgaagacgatataatg
ggtgattag

DBGET integrated database retrieval system