KEGG   Uncinocarpus reesii: UREG_02218Help
Entry
UREG_02218        CDS       T01132                                 

Definition
(RefSeq) similar to mannitol-1-phosphate dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ure  Uncinocarpus reesii
Pathway
ure00051  Fructose and mannose metabolism
ure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    UREG_02218
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     UREG_02218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 8440898
NCBI-ProteinID: XP_002542702
UniProt: C4JEQ8
AA seq 1007 aa AA seqDB search
MGKKAIHFGGGNIGRGFVGEFLHESGYEVVFVDVMDSVIEALQNASSYKVTEVSNEGEQT
KTITNYRAINSKHNLDQVISEISTADVVTCAVGPNILKFIAPPIAKGINARTIEKPLAVV
ACENAIGATDTLHGFIKENTDASRVESLPSRARFANSAIDRIVPTQAPNSGLDVKIEKFY
EWVVDKTPFGEWGHPEIKAIHWVDNLDPYIERKLYTVNTGHATAAYYGYNMGKKTIYEAM
SDEKIRGYVNDALSETSALIVDKHGIAAEEQRKYVDAIITRISNPHLEDVVQRVGRAPLR
KLGRKERFIGPASQLAERGKKVDALLGALEQALRFQNVPDDDESFELAKILKAESAEAAT
TKLTGLEKDHPLFARVVERVSKHLQHSTSGERCYGKDMILLERHHAICKKTAKKGQNDDM
KSQSDMTRLRVFRVHTQLLAVDPLEDNEYDDEKHLASITALTGPPHSITEEKDTAVLWSL
VTGRIEQGGLCGGALERWLPEGITQRLAATGWSARKRHELGGSGCWGQDAVRVPYALIRP
CIASIPLHWSPSPGKPELLERSSFQQSRNKALPYFIVIGSGIPLVVSGKDPVLAPVLVIS
STGFNESETASIHSNAPSYVSAAPSYHSSAPPHHVRASDIAAGRGNDWHGRNNSLPQSST
LNLSQQSGLPSAQRYAPGFETRGGDLSNANIRSLYNIAEWVPVTGGLQARHYHNVAKRRV
TDTSRFFPSLFSGQASGSRYDNAGMPEAFQRRFTAPSLSTGGISQAGESHNLSSSSLVNS
SIQDPAVRADSPHTAAGSSSSLVNSLHNSAGDLPFSPLEDPDLVGEAAAARFRSQRIYRV
LQQEENFYQQSQSSSSNLAQDPRPSAHVYQYSSLISEADNPRLPQRPSTAPGLSSEQSPE
EAGPSDQRITATSRQRSNTTADYDEILRAQESKTWDSMLAQMADWEERQRSWKRFKEDVD
RRLNSSRKVGMGWPVWSSGNGKRKLKKEQFGSHPGLKKWKSKVGLAN
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaaagcgattcactttggtggcggcaacattggccgtggcttcgtcggtgaa
ttcctccacgagtctggctatgaagttgtcttcgtcgatgtgatggactcggtcatcgag
gcccttcaaaacgcctcttcctacaaggtcaccgaggtcagcaatgagggagagcaaacc
aagaccattaccaactaccgtgctatcaattccaagcataacctcgaccaggtcatcagt
gagatctccaccgccgatgtcgttacctgtgccgtcggccccaatatcctcaagttcatt
gccccaccaatcgcgaaaggcatcaatgctcgtaccattgagaagccactggccgtggtt
gcctgcgagaatgccattggcgccaccgataccctccacggcttcatcaaggaaaacact
gatgcctctcgtgtcgaatcccttccctccagagctcgattcgccaattctgccatcgac
cgtatcgtccctacccaagcccctaactctggcctcgacgtgaagattgaaaagttctat
gaatgggtggtggacaagacaccgtttggcgaatggggtcaccctgagatcaaggctatt
cattgggttgacaacttggatccatacattgagcgcaagctttacactgtcaacaccgga
catgctaccgctgcatactacggctacaacatgggaaagaagaccatctacgaagctatg
agcgacgagaagattcgtggctacgtcaatgatgctctttcagagacctcggctcttatt
gtcgacaagcacggcattgcagctgaggagcagcgcaagtacgttgacgccatcatcacc
cgcatttccaacccccatctcgaggatgttgtccaacgtgtcggtcgcgcgccacttcgt
aagcttggacgcaaggagcgcttcatcgggcccgcttctcaattggcagagcgtggaaag
aaggtcgatgcccttttgggtgctttggaacaagcccttcgattccagaacgtcccagac
gacgacgagagcttcgaactcgccaagatcttaaaggctgaatcagcggaagctgccacc
acaaaattgaccggcttggagaaggatcatccgctctttgcgcgtgtggtcgagcgtgtc
tcaaagcatctccaacattcgacatctggggaacggtgttacggaaaggatatgatatta
ctggagcgtcatcatgcgatttgcaagaaaacggcaaaaaagggacaaaatgacgacatg
aaatcacaaagcgatatgactcgtttgcgagtattccgcgtacatacgcaactactagct
gttgatccactcgaagataatgaatacgacgatgagaagcatctcgcatctatcacggcg
ttaaccggaccgccgcactccattaccgaggaaaaggacaccgctgttctatggtcattg
gtgacagggcgtattgaacaggggggtttgtgtggcggtgcacttgagcgttggcttcca
gaaggaatcactcaacgactggccgcaacgggctggtcggctcggaaaaggcacgaactt
gggggctccgggtgctggggacaagatgctgttcgtgtgccatatgccctgattcggcct
tgtatcgcgagcatcccgctgcattggtctccctcccctggcaagccggaactacttgaa
cgatcatccttccagcaatccaggaacaaggctcttccatatttcatcgtcattggctct
ggtatccctctcgttgtcagtgggaaagatccggtgcttgcgcctgtgttggtgatatca
agtacgggcttcaatgagtcggagacggcttccatccattcaaacgccccttcgtatgtc
tctgcggccccttcctaccattcttctgcgccgccacatcacgtaagagcaagtgatatt
gcagctggtcgggggaacgattggcacgggcgaaacaactcgttaccacagtcctcgact
ttgaacctttcccagcaatctggtctaccttcagctcaaaggtatgcccccggttttgaa
actcgaggtggggatctatcgaacgcgaatattcgatccttgtataatattgcggagtgg
gttcctgtcacggggggtctgcaggctcgccattatcacaatgttgccaaaagacgggtg
acggatacttcgaggttttttccatctttattctcaggccaggcgagtggatctcgatat
gacaatgctggcatgcctgaggcgtttcagcgccgcttcactgccccaagtttgagtact
ggcggtattagtcaggctggagaaagccataatttatcctcttctagcctggtcaacagt
tctattcaggatcctgctgttagagcggactcccctcacactgccgccggaagcagttct
tcgctggtgaactctttgcacaattctgctggggaccttccattttctccccttgaagac
cccgacttggtcggagaggcagctgcagcaagattccgctcgcagcgcatttacagagtc
cttcaacaggaagagaacttttaccaacaatcccaatcctctagctctaatctcgcgcag
gaccccaggccatccgcccacgtataccagtacagttcattgattagtgaagccgataac
ccacgcctgccgcaacggccatccactgcacctgggctatcctctgagcagtccccagag
gaggccggcccgtcagaccagcgcataacggctaccagtcgtcagcgctccaacaccaca
gccgactacgacgagattctccgcgcccaggaatctaagacctgggactctatgcttgca
caaatggcagactgggaagagcgccagcgtagctggaagcgtttcaaagaggacgttgac
aggagattgaattcgagccgaaaagtcggcatggggtggcccgtctggtcctctggtaat
gggaaaaggaagctgaagaaggagcagtttggtagccatccgggactaaagaaatggaag
agcaaagtcggcttagcgaactga

DBGET integrated database retrieval system