KEGG   Uncinocarpus reesii: UREG_02453Help
Entry
UREG_02453        CDS       T01132                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 1
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ure  Uncinocarpus reesii
Pathway
ure00670  One carbon pool by folate
ure01100  Metabolic pathways
ure01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    UREG_02453
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     UREG_02453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 8437964
NCBI-ProteinID: XP_002542937
UniProt: C4JG55
AA seq 625 aa AA seqDB search
MHIKDKLAHSEAAGRPSISFEFFPPKTAQGVQNLYDRMDRMHGLGPSFVDITWGAGGRLS
DLTAEMVNVSQSVYGLETCMHLTCTDMPREKVDWALQSAYKAGCTNILALRGDPPREKEA
WAPTEGGFQYAKDLVKYIREKYGNHFDIGVAGYPEGCEDQEDPELLMTHLKEKVDAGGTF
IITQMFYDVDIFLDWVKRCREQGIKVPILPGIMPISTYAAFLRRSNWVKCRVPPSWMEAL
EPCKNDDAAVKQIGKKLVSEMCRKILDSGIRHLHFYTMNLAQSTKMVLEELDLIPSSETP
LQKPLPWRQSLGLGRREEDVRPIFWRHRHQSYVARTQTWDEFPNGRWTDSRSPAFGELDV
YGIGLKGTNEQNIKLWGEPKSIKDLSSIFVRFLEAKLDRLPWSESSITEETDIIKQDLID
LNNRGFLTINSQPAINGASSSHPVYGWGPKNGYVYQKAYLELLIPPEIIDEVITRIQKNA
DLTYYATNKNGELKTNTSDSPNAVTWGIFASKEVIQPTIVETVSFLAWKDEAYRLGDDWA
KCHDARSPSRQLIQRVMDEWYLVNIVNNDFHKTHDIFDLFKDLTVKGLDVELTEIVDPAS
QPADAILGQLNGDTTQDIKGNGQSN
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcaaagacaagctggcccattcggaggccgccgggcggccaagcatctcgttt
gaattctttccacccaagaccgcgcaaggtgtgcagaacctttacgatcgtatggaccgc
atgcatggacttggcccttctttcgttgacataacttggggagctggaggccgattatca
gacctaacagccgaaatggtcaatgtctcccaatccgtttatggcctcgagacatgtatg
catcttacatgcactgatatgccacgtgaaaaggtcgattgggctttgcagtctgcctac
aaggctggttgtaccaacattcttgcacttcgaggcgatcctccccgagaaaaagaagca
tgggctcccacagaaggcgggtttcagtatgcaaaagaccttgtgaaatatattcgagaa
aaatatggcaaccactttgatattggagtcgcgggctaccccgaaggatgcgaagaccaa
gaagatccagaacttctaatgacgcacttgaaggagaaggttgatgccggtggcaccttc
attataactcaaatgttctacgacgttgacatctttcttgattgggtgaagagatgccgt
gaacaaggtatcaaggtgccaatcctccccggaatcatgccgatatctacctacgctgcg
ttcttgagaaggtcgaactgggtgaaatgtcgagttccaccctcgtggatggaggccttg
gaaccttgtaagaatgacgatgctgccgtcaaacaaattggtaaaaaacttgtctctgaa
atgtgtcgaaagatcctagactcggggatccgtcatttgcacttttacacgatgaattta
gcccaatctactaaaatggtcctggaagagcttgatctgattccgtcgtcggaaactcca
ctacagaagcctttgccatggcggcagtcacttggtctcggccgaagagaggaggatgtc
cgccctatattttggagacaccgtcaccagtcatatgttgctcgcacgcagacgtgggac
gaatttcccaatggtcgttggactgattcgcgctcccccgcgttcggtgagctcgatgtt
tatggcatcggcttgaaaggcactaacgagcaaaacataaaactctggggtgagccaaag
tccatcaaagatctgtcaagcattttcgttcgattcctggaggccaagcttgataggctc
ccttggagcgagagttccataacggaggaaacagacatcatcaaacaagacctgatcgac
ttgaataaccggggtttcttaaccatcaactcccaaccagccatcaatggtgcgtcctcc
tcgcacccagtgtacggatggggaccgaaaaatggctacgtttatcaaaaggcatacttg
gaactcctcattccgccagaaataattgatgaagtgatcactcgtattcagaaaaacgcc
gatcttacatattacgctacaaataagaacggagagttgaaaacaaacacgagcgacagc
ccgaatgccgtcacttggggtatttttgcttccaaagaagttatccaacctactattgtt
gagactgtcagctttttggcctggaaagacgaggcgtaccgactgggagacgactgggca
aaatgccacgatgctcgtagtccaagtaggcaattgattcaacgcgtgatggacgaatgg
taccttgttaatatcgtcaacaatgatttccataaaactcacgacatcttcgatcttttc
aaggacctcactgtgaagggcctcgacgtcgaactgaccgaaatcgtcgatcccgcttct
caaccagcagatgccattttgggacaactgaatggtgacactactcaggacatcaagggc
aacgggcagtctaattag

DBGET integrated database retrieval system