KEGG   Uncinocarpus reesii: UREG_03219Help
Entry
UREG_03219        CDS       T01132                                 

Definition
(RefSeq) heat shock 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ure  Uncinocarpus reesii
Pathway
ure03040  Spliceosome
ure04141  Protein processing in endoplasmic reticulum
ure04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ure00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    UREG_03219
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    UREG_03219
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    UREG_03219
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ure01009]
    UREG_03219
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ure03041]
    UREG_03219
   03009 Ribosome biogenesis [BR:ure03009]
    UREG_03219
   03110 Chaperones and folding catalysts [BR:ure03110]
    UREG_03219
   04131 Membrane trafficking [BR:ure04131]
    UREG_03219
   03051 Proteasome [BR:ure03051]
    UREG_03219
   03029 Mitochondrial biogenesis [BR:ure03029]
    UREG_03219
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ure04147]
    UREG_03219
Protein phosphatases and associated proteins [BR:ure01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     UREG_03219
Spliceosome [BR:ure03041]
 Complex B
  Other components
   Prp19 complex
    UREG_03219
 Complex C
   Prp19-CDC5 complex
    UREG_03219
Ribosome biogenesis [BR:ure03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    UREG_03219
Chaperones and folding catalysts [BR:ure03110]
 Heat shock proteins
  HSP70 / DNAK
   UREG_03219
Membrane trafficking [BR:ure04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    UREG_03219
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    UREG_03219
Proteasome [BR:ure03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    UREG_03219
Mitochondrial biogenesis [BR:ure03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    UREG_03219
Exosome [BR:ure04147]
 Exosomal proteins
  Proteins found in most exosomes
   UREG_03219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 8439649
NCBI-ProteinID: XP_002543702
UniProt: C4JPP7
AA seq 651 aa AA seqDB search
MAPAIGIDLGTTYSCVGIFRDDRIEIIANDQGNRTTPSFVAFTDTERLIGDAAKNQVAMN
PTNTVFDAKRLIGRKFADAEVQADMKHFPFKIIDKAGKPVIQIEFKGETKQFTPEEISSM
VLTKMRETAESYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIA
YGLDKKTEGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFV
NEFKRKHKKDLSSNARALRRLRTACERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRARF
EELCQDLFRSTMEPVERVLRDAKTDKSSVHEIVLVGGSTRIPKIQKMVSDFFNGKEPNKS
INPDEAVAYGAAVQAAILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTPLIKRNTTIP
TKKSETFSTFSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQIEVTFDLD
ANGIMNVSALEKGTGKTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIAAKNG
LESYAYSLRNTMSDSKVEEKLDAGDKEKLKSEVDKIVAWLDDNQTATKEEYEDRQKELEG
VANPIMMKIYGAGEGGAPGGFPGAGGPGGFPGGAAPGGHGGDDGPTVEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggctccagcaattggtattgatctgggcaccacctactcctgcgtgggtatcttccgt
gatgaccgcattgaaatcatcgccaacgaccagggtaaccgcacaaccccctcgttcgtt
gctttcacagataccgagcgtttgatcggagatgctgcaaagaatcaagtcgccatgaac
cccaccaacactgtcttcgatgccaagcgtcttatcggtcgtaaattcgccgatgctgaa
gtccaggccgacatgaagcacttcccattcaagattatcgacaaggctggaaagccagtc
atccagattgaattcaagggcgagaccaagcagttcactccagaggaaatctcttccatg
gtcttgaccaagatgagagaaactgccgagtcttacctcggtggcaccgttaacaatgcc
gtcgtcactgtcccggcctacttcaacgactcccagcgtcaggctaccaaggatgccggt
ctcattgctggtctcaacgttcttcgtatcatcaacgagcctactgccgctgctatcgcc
tatggattggacaagaagaccgagggtgagcgcaacgtcttgatcttcgatttgggtggt
ggtactttcgatgtctccctcttgaccattgaggagggtattttcgaagtcaagtccacc
gctggtgacactcacttgggtggtgaggactttgacaaccgccttgtcaaccattttgtc
aacgaattcaagcgcaagcacaagaaagatctctcctccaatgctcgtgctctccgtcgt
ctccgcactgcttgcgagcgtgccaagcgcactctttcttccgctgcccagacctccatc
gagatcgactctctctttgagggtatcgatttctacacttccatcactcgtgctcgtttc
gaagagctttgccaggacctcttccgttccacaatggagcctgtcgagcgtgtcctccgt
gatgccaagaccgacaagtcctctgttcacgaaatcgtcttggtcggcggttctactcgt
attcccaagattcaaaagatggtttccgacttcttcaatggaaaggagcccaacaagtcc
atcaaccccgacgaagccgtcgcttacggtgccgctgtccaagctgctatcctgtctggt
gacacatcttccaagtccaccaacgaaatcctcctccttgacgtcgcccctctttccctg
ggtatcgaaactgctggtggtgtcatgactcctctcatcaagcgtaacaccactattccc
accaagaagtccgagactttctctactttctccgacaaccagcctggtgtgttgatccag
gtctatgaaggtgaacgtgctcgcaccaaggacaacaacttgctcggcaaattcgaactt
accggcattcctcccgcaccccgtggtgttccccagattgaggtcactttcgatctcgac
gccaacggtatcatgaacgtctccgccctcgagaagggtactggaaagaccaacaagatt
gtcatcaccaacgacaagggccgtctctccaaggaagaaatcgagcgcatgttggctgag
gctgagaaatacaaggctgaagatgaggctgaagctgcacgtattgctgccaagaacggg
cttgagtcctatgcttattccctccgcaacaccatgagcgactccaaggttgaagagaag
ctcgacgctggcgacaaagagaagctcaagtccgaggtcgacaagattgttgcctggctc
gatgacaaccagactgctaccaaggaagagtatgaagacagacagaaggagcttgaaggt
gttgccaaccccatcatgatgaagatctacggagctggtgaaggtggtgctccaggtgga
ttccccggtgccggtggacctggtggattcccaggcggtgctgctcctggcggtcatgga
ggtgatgacggcccaaccgtcgaggaggtcgactaa

DBGET integrated database retrieval system