KEGG   Uncinocarpus reesii: UREG_03588Help
Entry
UREG_03588        CDS       T01132                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ure  Uncinocarpus reesii
Pathway
ure00620  Pyruvate metabolism
ure00630  Glyoxylate and dicarboxylate metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01200  Carbon metabolism
Module
ure_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UREG_03588
   00630 Glyoxylate and dicarboxylate metabolism
    UREG_03588
Enzymes [BR:ure01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     UREG_03588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 8443721
NCBI-ProteinID: XP_002544071
UniProt: C4JL80
AA seq 539 aa AA seqDB search
MTSVDAQLKDVAILGHISEPARKILTRDACAFLALLHRAFNGTRKALLQRRIARQAEIDR
GQLLDFLPETRHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNSDVWTYMADFE
DSSAPTWENMVNGQVNLYDAIRRQVDFVQGGKEYKLRTDRKLPTLIARARGWHLEEKHFT
VDGEPISGSLFDFGLYFFHNAHELVKRGAGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRGTVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRQNPNFVLPDR
SSVTMTVPFMDAYVRLLIKTCHRRGVHAMGGMAAQIPIKNDPKANEAAMESVRADKLREV
RAGHDGTWVAHPVLASIASDVFNKYMPTPNQLFVRREDVHVTANDLLNTNVPGSITEDGI
RKNINIGLSYMEGWLRGVGCIPINSLMEDAATAEVSRSQLWQWARHNAKTAEGKKVDKAY
NLKLLKEQADELASKGPKGNKYQLAARYFAGQVTGEDYADFLTSLLYNEISAPGSAAKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgtcgacgcccagctgaaggatgtcgccatcctcggccatatcagtgaaccg
gcccgcaagatcctcaccagagacgcctgtgcgttcctggctctcctgcaccgtgcattc
aatggcaccagaaaggcgctgcttcaacgacgcattgcccgtcaagcagagatcgaccgg
ggccagctcctagacttcttgccagaaaccagacacatccgtgaaaacgatgcctggaaa
ggcgctcctcccgcgccaggattggttgaccgccgtgtcgaaatcaccggtcctaccgat
cgaaagatggttgtgaatgcattgaactcggatgtgtggacctacatggccgatttcgaa
gattcaagcgctccgacctgggaaaacatggtcaacggccaggtaaacttgtatgacgct
attcgccgccaggtcgacttcgtgcaaggtggaaaagaatacaaactccgcaccgaccgc
aaactgcccacactcatcgcccgagctcgaggctggcatttggaggaaaagcatttcacc
gtcgacggagagccaatctctggtagtttgtttgattttggtctctatttcttccacaac
gcccacgagttggtcaaaagaggcgccggcccatatttctacctcccaaagatggaatcg
cacttggaagcccgtctgtggaacgatgtcttcaacctggcccaggactatatcggtatg
cccagaggcacgatccggggcactgtgctgattgaaaccatcaccgccgcgtttgagatg
gacgagatcatctatgaactcagagaccacagctccggcctgaactgcggaagatgggat
tatatcttctccttcatcaagaaattccgccagaatcctaacttcgtgctccccgatcgt
tcctccgtcaccatgaccgtgccattcatggatgcttatgtccgactcttgatcaagact
tgccatagacgcggtgtgcacgcaatgggtggcatggctgctcaaatcccaatcaagaac
gaccccaaggccaacgaggctgccatggaaagcgtgcgtgccgacaagctccgtgaagtg
cgtgcaggccacgacggcacatgggttgcccatcccgttctggcatcaattgcttctgat
gtgtttaacaaatacatgcccactcccaaccagctcttcgtccgaagggaggatgtccat
gtaaccgccaatgaccttctcaataccaatgttcctggtagcatcaccgaagacggcatc
agaaagaacatcaatattggcctgtcatacatggaaggatggctccgcggtgtcggctgc
attcccatcaacagtctgatggaggatgctgctactgctgaagtgagccgaagccagctt
tggcaatgggctcgacataacgccaagacggcagagggcaaaaaggtcgacaaagcttac
aacttgaaactcttgaaagagcaagcggatgagctcgcctccaagggccccaagggcaac
aagtaccagcttgctgcccgctatttcgctggccaggtgaccggagaagactatgcagac
ttcttgacatcgctgttatacaacgagatctcggctcctggaagtgcagctaagctgtaa

DBGET integrated database retrieval system