KEGG   Uncinocarpus reesii: UREG_04161Help
Entry
UREG_04161        CDS       T01132                                 

Definition
(RefSeq) glycyl-tRNA synthetase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
ure  Uncinocarpus reesii
Pathway
ure00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ure00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UREG_04161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ure01007]
    UREG_04161
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ure03016]
    UREG_04161
   03029 Mitochondrial biogenesis [BR:ure03029]
    UREG_04161
Enzymes [BR:ure01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     UREG_04161
Amino acid related enzymes [BR:ure01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   UREG_04161
Transfer RNA biogenesis [BR:ure03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    UREG_04161
Mitochondrial biogenesis [BR:ure03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    UREG_04161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b
Motif
Other DBs
NCBI-GeneID: 8437173
NCBI-ProteinID: XP_002544644
UniProt: C4JMV3
AA seq 641 aa AA seqDB search
MATTKTGQPLDRSVLDSMLRRRLFYTPSFDIYGGVSGLFDYGPPGCALQANIVDIWRKHF
VLEEDMLETSGHVDKFADWMCKDPKTGEIFRADHLVEEVLESRLKGDKEARGEKVQVDEE
KEAKKKKKAKETKAVKLDDAVVTEYEEILAQIDNYNGEELGALIIKHNIKNPVTGGDVLP
PVSFNLMFQTAIGPSGHIPGYLRPETAQGQFLNFQKLLDFNQQSMPFASASIGKSFRNEI
SPRSGLLRVREFLMAEIEHFVDPEGGKKHPRFHEVENTELSFLSREVQLSGSTKPIRMTI
GKAVSTGLVDNETLGYFLARIYMFLMKIGIDQSKVRMRQHMANEMAHYATDCWDAELLTS
YGWIECVGCADRSAYDLSVHKKKTGAPLVVRETRAEPLRIEEWQIDIDRKKFGPRFKKDG
KTVEAAIDALSQELREKLALDLTKDGKISVEVENVNDGKVELGKDLIQIEKRTRVENVRE
YTPNVIEPSFGIGRILYCLMEQTYWSREGDEARGVLSFPPIVAPTKVLLVPLSSHSSFQP
LVRQLTLKLRRMGVSNRVDDSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDS
MKQVRASEDEICKAVKSLVEGDETWEDVRKRLPEFLGQEVE
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctaccacaaaaactggtcagcctttagacagatccgtcttggactctatgctccgg
agacggctgttctacactccttccttcgacatttacggcggggtatctggtctcttcgat
tacggtccgccgggatgcgctctgcaggcgaatattgtggacatttggagaaagcatttt
gtgctagaagaagacatgcttgagacaagtgggcacgtggacaagtttgcagactggatg
tgcaaagatcccaagaccggcgaaatcttccgagcagaccatctggtcgaggaagtattg
gagtcgcgattgaagggcgacaaggaagcgcggggagaaaaggtgcaggttgacgaagaa
aaggaggcgaaaaagaaaaagaaggccaaggagacaaaggcagtcaagctcgatgatgca
gtggtcacggaatatgaagaaattcttgcacagatcgataactacaatggcgaggaactc
ggtgctcttattatcaaacacaatatcaagaatcctgtgactggtggtgatgttcttccc
ccagtgtccttcaatctgatgttccaaactgccattggccccagcggacatatccctggg
tacctccggcctgaaaccgcgcaagggcagttccttaacttccaaaagctgctggatttt
aaccagcagtcaatgccatttgcttctgcgtccattggtaaatccttccgcaacgaaatc
tcgccccgttccggccttctgcgagtgcgcgagttcttgatggctgagattgaacatttc
gttgaccctgagggtggcaagaaacaccctcgtttccatgaggtcgaaaatacggagcta
tcttttctgagccgagaagtccagctctctggaagcacaaagcccattcgcatgacgatc
ggaaaggccgtctccactggcttggtagacaacgagacccttggctatttccttgctcgc
atttacatgttcctcatgaagatcggcattgaccaatctaaggttcgcatgcggcaacac
atggcaaacgaaatggcacactacgctaccgactgttgggatgctgaactgctcactagc
tatggctggattgaatgcgttggctgtgccgatcgcagcgcgtatgatctcagtgttcac
aagaagaagactggtgctcctttggtcgttagagaaacccgagcggagccgcttcgtatt
gaagaatggcaaattgatatcgacaggaaaaagttcggcccacgcttcaagaaagatgga
aagacagttgaagctgccatcgatgccttatctcaggagcttcgtgaaaagctcgccttg
gatctcaccaaggacgggaagatctccgttgaggtggaaaatgtcaacgatggaaaggtc
gaacttggtaaagaccttattcaaattgaaaagcgtactcgagtggaaaacgttcgtgaa
tacacgcctaacgtcattgagccctcttttggcattggaagaattttgtattgtctgatg
gagcagacttactggtcaagagaaggagacgaagctcgcggagtattatcgttccctcca
atcgtagcgccaacaaaagtcctccttgttcccctgtccagtcattcatccttccagcca
cttgttaggcaactgacgctcaaacttcgccgtatgggcgtctccaaccgtgtggatgat
agctccgcaagtatcgggaaacgctatgctagaaatgacgaacttggaacacctttcggc
atcactgtcgatttccaatctgttaaagacaacacattcactttgcgagacagggatagc
atgaagcaggtccgtgctagcgaagacgagatttgcaaagcagttaaatcgctggtagaa
ggcgacgagacatgggaggatgtgaggaaacgacttccagaatttctcggacaagaggtg
gaataa

DBGET integrated database retrieval system