KEGG   Uncinocarpus reesii: UREG_04332Help
Entry
UREG_04332        CDS       T01132                                 

Definition
(RefSeq) succinyl-CoA ligase alpha-chain
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ure  Uncinocarpus reesii
Pathway
ure00020  Citrate cycle (TCA cycle)
ure00640  Propanoate metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
ure01200  Carbon metabolism
Module
ure_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ure_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UREG_04332
   00640 Propanoate metabolism
    UREG_04332
Enzymes [BR:ure01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     UREG_04332
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     UREG_04332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 8438317
NCBI-ProteinID: XP_002544815
UniProt: C4JNC6
AA seq 331 aa AA seqDB search
MQSFKRSTLSALQNAARAQRRGYSKPTSAYASTVENLRINSETKVLYQGFTGKQGTFHAQ
QAIDYGTKVVGGTNPKKAGEMHLDRPVFATVRDAIKETGANASAIFVPPPVAAKSIEEAI
EAEMPLVVCITEGIPQHDMVRITDILKTQNKTRLVGPNCPGIIAPGQCKIGIMPGFIHKR
GRIGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLRVFLEDEETDGII
MIGEIGGSAEEDAAEFFKAANKANKPAVGFIAGISAPPGRRMGHAGAIVSGGKGGADSKI
AALEAAGVIVERSPAALGKTLHAEFVKRDLI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccttcaagcgcagtacgctctctgctctgcagaacgccgcccgcgcccagcgc
cgcggatacagtaaaccaacgtctgcgtacgcctcaacggtcgagaatctccggatcaat
agcgagacaaaggtcctctaccagggatttactggaaagcagggaacattccacgcccag
caggccatcgactatggtaccaaggtcgtcggcggtacgaatcccaaaaaggctggagaa
atgcatctcgatcgtccagtgtttgcaacggtgagagacgctatcaaagaaactggcgcc
aatgcttccgccatctttgttcctcctccggtggctgcaaagagtatagaggaggcaatt
gaggcagagatgccgcttgtcgtttgcattactgaaggaatcccgcagcacgacatggtt
cgcattaccgacatcctgaaaacgcaaaacaaaactagattagtcggtcctaactgtcct
ggtataatcgctccgggccaatgcaaaattggcatcatgcctggatttatccacaagaga
ggacgcatcggcatcgtctcacgatctggaacccttacatacgaggctgtgaatcagacc
acccaagctggccttgggcaatccctcgttgtcgggattggtggtgacccgttctccggc
accaacttcatcgattgcctccgcgtcttcctcgaagacgaggagaccgacggtatcatc
atgattggtgaaattggaggtagcgccgaagaagatgccgcagagttcttcaaagctgcc
aacaaagcaaacaagccggctgttggtttcattgccggtattagtgcgcctcccggccgc
cgaatgggccacgcaggtgctattgtgagcggcggcaagggcggagccgactcgaaaatt
gctgctcttgaggcggcgggtgtcatcgtcgagcggagcccagctgcccttggaaagacc
ttgcacgctgaattcgtgaagagagatttgatctag

DBGET integrated database retrieval system