KEGG   Uncinocarpus reesii: UREG_04952Help
Entry
UREG_04952        CDS       T01132                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure00010  Glycolysis / Gluconeogenesis
ure00051  Fructose and mannose metabolism
ure00562  Inositol phosphate metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
ure01200  Carbon metabolism
ure01230  Biosynthesis of amino acids
Module
ure_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ure_M00002  Glycolysis, core module involving three-carbon compounds
ure_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UREG_04952
   00051 Fructose and mannose metabolism
    UREG_04952
   00562 Inositol phosphate metabolism
    UREG_04952
Enzymes [BR:ure01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UREG_04952
Exosome [BR:ure04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UREG_04952
  Exosomal proteins of bladder cancer cells
   UREG_04952
  Exosomal proteins of melanoma cells
   UREG_04952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 8438006
NCBI-ProteinID: XP_002584263
UniProt: C4JUZ9
AA seq 249 aa AA seqDB search
MARKFFVGGNFKMNGTQKSIADIISNLNNANLDPNTEVVLSPPALYLLLTRSQADPKFGV
AAQNVFDKPMGAYTGELSVEQLHDCGVSWALVGHSERRVILKEDDDFAARKTKAAIDGGL
GVILCVGETLEERESGKTVDVVTRQLGAVASRLSVQDWAKVVIAYEPVWAIGTGKVATTE
QAQEVHAALRKFVADSISPSVAENIRIIYGGSVNDKNCQELAKQPDVDGFLVGGASLKPA
FVDIINARL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaaattctttgtcggcggtaacttcaagatgaacggcacccaaaagtccatt
gccgacatcatcagcaacctcaacaacgccaatcttgaccccaacaccgaagtcgtcctg
tcccctcccgctctctacctcctcctcacccgcagccaagccgaccccaaattcggcgtc
gcggcgcagaatgtgtttgataagcccatgggagcgtatactggtgaattgagcgtagag
cagctgcacgactgcggtgtttcgtgggccttggtcggccacagtgagcggagagtgatc
ttgaaggaggatgatgatttcgctgcacgtaagaccaaggctgctattgacggcgggttg
ggcgttatcctctgtgttggcgaaactctcgaggagcgcgaatccggcaaaaccgtcgac
gtcgtgaccagacagctgggtgctgtggcttccagactcagtgttcaagactgggccaag
gttgttattgcctacgagcccgtgtgggctattggaacgggcaaggttgccaccaccgag
caagcccaagaagtccatgctgcgctccgcaagttcgtcgcggacagcatctcgcccagt
gttgctgagaacatccgtatcatctacggaggcagcgttaacgacaaaaactgccaagag
ctcgcgaagcaacccgatgtggatgggtttttggtgggcggtgccagtttgaagccagcc
ttcgttgatatcatcaatgctcgtctatga

DBGET integrated database retrieval system