KEGG   Uncinocarpus reesii: UREG_05080Help
Entry
UREG_05080        CDS       T01132                                 

Definition
(RefSeq) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure00010  Glycolysis / Gluconeogenesis
ure00620  Pyruvate metabolism
ure00640  Propanoate metabolism
ure00680  Methane metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
ure01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UREG_05080
   00620 Pyruvate metabolism
    UREG_05080
   00640 Propanoate metabolism
    UREG_05080
  Energy metabolism
   00680 Methane metabolism
    UREG_05080
Enzymes [BR:ure01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     UREG_05080
Lipid biosynthesis proteins [BR:ure01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   UREG_05080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 8439201
NCBI-ProteinID: XP_002584391
UniProt: C4JRJ1
AA seq 700 aa AA seqDB search
MSESPAEPKAPVVIEAHQVDTFHVPEAFHHNHPHGPHLRNMDEYNRLYQESINDPDTFWA
RMARELITFDKDFVKTHIGSFAGGDNAWFVGGRLNASYNCVDRHAMQNPDKTAIIYEADE
PDQGRYITYGELLKEVCQLAWVLKSQGVKKGDTVAIYLPMIPEAIVALLACARIGAIHSV
VFAGFSSDSLRDRVLDARSKFVITADEGKRGGKLIGTKKIVDEALKQCPDVVNCIVFKRT
GADVPWTKGRDLWWHEEVEKYPNYIPVEPMDSEDPLFLLYTSGSTGKPKGVMHTTAGYLV
GAAATCKYVFDVHRDDRFFCGGDVGWITGHTYVVYAPLLLGCATVVFESTPAYPNFSRYW
DVIEKHKVTQFYVAPTALRLLKRAGDHHINHEMKDMRVLGSVGEPIAAEVWKWYHDVIGK
RQAHVVDTYWQTETGSHVITPLAGITPTKPGSASLPFFGIDPAILDPVTGVEVHGNDVEG
ILAFKKPWPSMARTVWGDHKRYMDTYFNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVNV
SGHRLSTAEIEAALIEHHSVAEAAVVGIPDPLTGQAVHAFVALKNSNENKEQLRKELVMQ
VRKSIGPFAAPKVVFVIDDLPKTRSGKIMRRILRKILSGEEDSLGDISTLSDPSVVSKIL
DTYHEWKKVVDAAASAAATVASNTATNAAAAISAKTTTAA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagtctcccgctgaaccaaaggccccagtggttatagaggcccaccaggtcgat
actttccatgtcccggaagcattccatcacaaccatccccatggaccgcacctgaggaat
atggatgagtacaaccggctctatcaagaatccataaacgaccccgacacgttttgggcg
cgcatggcgcgcgagcttatcacatttgataaagatttcgtcaaaactcacattgggtct
tttgctgggggggataacgcatggtttgtcggtggtcgcctgaacgcttcgtacaattgt
gtcgaccgtcatgccatgcagaatccagacaagacggctataatatatgaagcagacgaa
cctgaccagggccggtatatcacctacggcgagttactgaaggaagtctgccagctggct
tgggttctgaagagtcagggtgttaagaaaggtgatactgtggcaatatatcttcctatg
attcccgaagccatcgttgcgctcctagcctgtgctcgcattggtgctattcattctgtc
gtctttgcaggtttctcttccgattccttgcgcgaccgtgttctcgatgcgcgatcaaag
ttcgttataaccgccgatgagggtaaacgtggcggaaaactcatcgggacgaagaagata
gtagacgaggcgttgaaacaatgcccagacgttgtcaactgcatcgtctttaaaagaacc
ggcgcagatgtaccctggaccaagggccgtgatttgtggtggcatgaagaagtcgaaaaa
tatccaaactatattcctgttgagccaatggattctgaggaccctcttttcctgctatat
acgtccggctcgactggaaaacccaagggggttatgcatacaacagctggctatcttgta
ggggcagccgccacttgcaaatacgtcttcgatgttcaccgtgacgaccgtttcttttgc
ggcggtgatgttggatggattacagggcatacatatgttgtctatgccccgttgcttctg
ggatgtgccactgtggtcttcgaaagcacaccagcataccctaacttttcccgttactgg
gatgttattgaaaagcataaggtgacccagttttatgtcgcaccaactgcgttgcggctt
ttgaaacgtgcgggcgaccatcatatcaatcacgaaatgaaagatatgcgcgttctgggc
tctgtaggcgaacctatcgcagctgaggtctggaagtggtaccatgatgttattggaaaa
agacaagcccacgtggttgatacatactggcaaaccgaaaccggctcccatgttatcact
cctctcgctggcatcacgccaactaagccaggaagtgcgtcgcttccattctttggtatt
gaccctgctatccttgatcccgttacgggcgtagaggtccacggaaatgatgtcgaggga
attcttgccttcaagaagccatggccaagtatggcccgcactgtgtggggtgatcataaa
cgatatatggacacttatttcaatgtctataaaggttattatttcaccggagacggcgcc
gggcgagaccatgaaggctattattggattagaggacgcgtggatgatgttgtgaacgtg
tctggtcatcgcctttcgactgcggagatcgaagctgctcttatcgaacaccactccgtt
gctgaagccgctgtcgttggtattccagacccattgacaggacaggctgtgcatgctttt
gttgccttgaagaatagtaacgagaacaaggaacaacttcgaaaagaactggtaatgcag
gttcgtaaatcgattggcccgtttgctgctccgaaggttgtgttcgtgatcgacgacctt
ccgaagacacgtagcggcaagatcatgagacggattttgcgcaagattttaagcggcgag
gaagatagcctcggcgacatctcaacgctttctgatcccagcgtggtttctaagattctt
gatacctatcatgagtggaagaaagtagttgacgccgccgcctctgctgctgccactgta
gcttccaatacggccaccaacgcagcagctgcgatctcagcgaaaacaacaaccgccgct
tga

DBGET integrated database retrieval system