KEGG   Uncinocarpus reesii: UREG_05336
Entry
UREG_05336        CDS       T01132                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ure  Uncinocarpus reesii
Pathway
ure00100  Steroid biosynthesis
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    UREG_05336
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     UREG_05336
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 8440517
NCBI-ProteinID: XP_002584647
UniProt: C4JS97
AA seq 472 aa
MPHKYEFGGPVGAAGIVFGLPPLMYFLYFTCNDISGCPAPALRDPANLTWEKLKAQIPWP
GSVSQFASWEVTGWVLAYYLFSLLLYRILPAQEIYGTKLRESGRPLKYRFNAFYSTIVHL
VLAGIGTYIYGADFVVWRYITDNYLQILTANVLLAYAISIYVYAGSFGVKPGNSELRELA
IGGQSGNVLYDFFIGRELNPRKTLPFFGEVDIKAWLEMRPGLTGWALLDLAFVAKQYRTY
GYVSDSIVFICCIQTYYVLEGQYAESGLLGMMDIITDGLGFMLTFGDIIWVPFLYSTQCR
YLSVYPVHLGWAGLAAVSITFAIGVSIFRAANSQKYTFRTKPDHPSVAGMSYIQTKRGTR
LLTAGWWGMARHINYFGDWLQSLPFCLPTALAGYLIFPAGSSIADAAKTLDGREVLATKG
AGMFYTYFYSAWFAFMLIHREQRDDAACSQKYGEDWERYKKLVKWRILPGVY
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgccgcacaaatatgagtttggaggcccggttggtgccgccgggatcgtgttcggcctt
cctcccttaatgtacttcttgtacttcacttgcaacgatatctcaggctgtcccgctccg
gctcttcgggaccctgcgaacctcacgtgggagaagctcaaggcccaaatcccatggccg
gggagtgtctcgcaattcgccagttgggaggttacgggctgggtgttggcatactaccta
ttcagtctgctgctttaccggattctgccggcgcaagagatttatgggaccaagctgcgc
gagtcggggcgtccgctgaaatatcggtttaatgccttttactcaaccatcgtccatctg
gttctggccggcattggtacttacatctatggcgcggattttgtggtttggaggtacatt
accgacaattacctgcaaatcttgactgcgaacgtcctcctggcctatgccatctccata
tacgtctacgccggcagtttcggtgtaaaacccggtaacagtgaactgcgagagctagcg
atcgggggccagtcgggaaacgtgctctacgatttcttcattggccgtgagctaaatcca
cgtaaaacgttgccgttcttcggcgaggtcgatatcaaggcgtggctagagatgcgtcct
ggcctgaccggctgggcactgctcgatcttgcctttgtggctaaacagtaccggacgtat
ggctatgtgtctgatagcatcgtgttcatctgctgcatccagacatactatgtgctcgag
ggccagtatgcggaatcgggcctcctgggtatgatggatatcatcactgatgggttaggg
ttcatgcttacctttggtgatatcatttgggtaccctttctgtactcgacccaatgccgg
tacctgtcggtctatccggtgcatctgggatgggcgggcctggctgccgtgagcatcaca
tttgccatcggcgtctctatattccgggccgccaactcccaaaagtataccttccgcacg
aaacccgaccatcccagcgtggcgggcatgtcatacatccagaccaagagaggcaccagg
ctgcttactgcgggttggtgggggatggcacggcacatcaactattttggcgattggctg
cagtccctgccgttttgtcttccgacggcgctggcgggctatctcatcttcccggctggg
agctccattgctgatgcggcgaagacgcttgacggtcgggaggtgcttgcgaccaagggg
gcgggcatgttctacacgtacttttacagcgcgtggtttgcgtttatgcttatccacaga
gagcagcgcgacgatgcagcgtgttcgcaaaagtatggtgaggattgggagagatataag
aagcttgtgaagtggaggattctgcccggggtttattaa

DBGET integrated database retrieval system