KEGG   Uncinocarpus reesii: UREG_05484Help
Entry
UREG_05484        CDS       T01132                                 

Definition
(RefSeq) succinyl-CoA:3-ketoacid-coenzyme A transferase 1
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
ure  Uncinocarpus reesii
Pathway
ure00072  Synthesis and degradation of ketone bodies
ure00280  Valine, leucine and isoleucine degradation
ure00650  Butanoate metabolism
ure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UREG_05484
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    UREG_05484
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UREG_05484
Enzymes [BR:ure01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     UREG_05484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-GeneID: 8443391
NCBI-ProteinID: XP_002584795
UniProt: C4JSP5
AA seq 500 aa AA seqDB search
MQHQGFLVRGFSSTFARSAINKVVPSAEDAIKDMKSDSTLLAGGFGLCGVPDTLINAVHN
NPKITGLTAVSNNAGVDGAGLGLLLASGQIKKMIASYVGENKTFERMYLSGQIDLELTPQ
GTLAERCRAGGAGIPAFYTPAAFGTVVQTGELPLRNNADGTVALYGTPRDVKVFDGKSYV
MEESIKGDYAFVKAWKADKLGNCQFRFAAQNFNGAMGRNAKMTIVEAEHIVEVGEIDPAS
VHLPGIYVKRVIQSTTEKKIEKYTFAKEGDEADMSALGKGDTANKRERIVRRAAKEFKNG
MYANLGIGMPMLAPNFVDPSVEVQLQSENGILGLGPYPKKGLEDADLINAGKETVTLLPG
ASCFGSDESFGMIRSGRIELTMLGAMQVSAKGDLANWMLPGKIKGFGGAMDLVSNPSKTR
VVVTMEHTDKKGNPKILKQCEFPLTGRACVSRIITELCVFDVDFTNGLTLIELADGVTVD
EVRAKTEAPFKVADDVKPML
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatcaagggttcctcgttcgggggttctcgagcacctttgcccgcagtgccatc
aacaaggtcgtgccgtctgccgaggatgccatcaaggatatgaaatccgactcgacgctg
ctggcgggaggctttgggctctgcggcgtgcccgacacgctcatcaacgctgtgcacaac
aacccgaagatcacgggcctcacggccgtcagcaacaatgccggtgtcgacggggccggg
ctgggcctgctgctggcgagcgggcagatcaagaagatgatcgcgagctacgtcggcgag
aacaagacgtttgagcgcatgtacctctccggacagattgacctggagctgacgccgcag
ggcaccttggccgagcggtgccgtgctggcggcgctgggattccagccttttacacgccg
gcggcctttggcacggttgtccagaccggcgagctcccgctgaggaacaacgccgatggc
acggtggcgctgtacggcacgccgcgcgacgtcaaggtgtttgacggcaagagctacgtg
atggaggagtcgatcaagggcgactacgccttcgtcaaggcctggaaggccgacaagctg
ggcaactgccagttccgctttgcggcgcaaaacttcaacggcgccatgggccgcaacgcc
aaaatgaccattgtcgaggcggagcacatcgtcgaggtcggcgaaatcgatccggcgtcg
gtgcacctgccgggcatctacgtcaagcgggtcatccagagcaccaccgagaagaagatt
gaaaagtacacgttcgccaaggagggcgacgaggccgacatgtctgcgctgggcaaggga
gacacggccaacaagcgggagcgcatcgtgcgccgcgcggccaaggagttcaagaacggc
atgtatgccaacctgggcattgggatgccgatgctggcgcccaactttgtcgacccgtcc
gtcgaggtgcagctgcagtccgagaacggcattctcggtctcggcccgtatcccaagaag
ggcctggaggatgcggatctgatcaatgccggcaaggagaccgtcacgctgctgcccggc
gcatcgtgctttggcagcgatgagtcctttggcatgatccgatcgggacgcatcgagctg
accatgttgggcgcgatgcaagtgagcgccaagggcgatttggccaactggatgctgccc
ggcaagatcaagggattcggcggcgccatggatctcgtctcgaacccgtccaagaccagg
gtcgtggtcaccatggagcacacggacaagaaaggaaaccccaagattctcaagcagtgc
gagttccctctgacgggccgagcgtgcgtgagcagaatcatcaccgagctctgcgtgttc
gacgtcgacttcaccaacggcttgactctgatcgagctggcggacggcgtgacggtcgac
gaggtgcgcgcaaagacagaggcgcctttcaaggttgccgacgacgtgaagcccatgctt
tga

DBGET integrated database retrieval system