KEGG   Uncinocarpus reesii: UREG_05728Help
Entry
UREG_05728        CDS       T01132                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ure  Uncinocarpus reesii
Pathway
ure00450  Selenocompound metabolism
ure00970  Aminoacyl-tRNA biosynthesis
ure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    UREG_05728
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UREG_05728
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ure01007]
    UREG_05728
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ure03016]
    UREG_05728
Enzymes [BR:ure01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     UREG_05728
Amino acid related enzymes [BR:ure01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   UREG_05728
Transfer RNA biogenesis [BR:ure03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UREG_05728
 Prokaryotic type
   Other AARSs
    UREG_05728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 RNA_polI_A34 PepSY
Motif
Other DBs
NCBI-GeneID: 8442984
NCBI-ProteinID: XP_002585039
UniProt: C4JTD9
AA seq 657 aa AA seqDB search
MGSQEKILPQKGQRNILITSALPYVNNVPHLGNIVGSVLSADVFARYHKACGRPTLYVCG
TDEYGTATETKALEEGVTPEQLCAKYNKIHQEVYEWFGIGFDIFGRTPTQKHTEISQRIF
KRLYDNGFLEEKTAEQPYCEKHESFLADRYVEGECPRCHYDDARGDQCDKCGNLLDPFDL
INPRCKVDGATPVSRPTKHIHLLLDKLQPQIEEWVRPAIEKGDWPKNSRVITESWLKEGL
KDRGITRDLKWGVPVPLEGYENKVLYVWFEACIGYPSITANYTDDWELWWRSPEDVQLYQ
FLGKDNVPFHAVIFPGCQLGTKDKWTMLHHLSTTEYLNYESGKFSKSRGIGVFGNNAKDT
GIPADVWRYYLLKNRPETGDTQFEWRSFIDANNGELLAKLGNLVNRVVKLIASPKAYSGV
VPDFTVQESFNPVLDDITTILRQYIEEMETVHLRAGLATAMRVAEAGNNLIQSNKLDNSL
IANEPERAATVVGIVINLIHLCASVFSPYLPATSKSILEQLDAPFANIPSLEDLKDGWKP
TAIKGGHKIGKAKYLFSTIDVKKADEWRAMFGGSQAERQKKEEEAAKLAAKKAANKAKKK
EKKKQPKGETEGEDTGKSVEASAKGGAEAVSATVEGGKDEAVEKIADGVAQVTIPTS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgggatcacaagagaagattttgccccaaaagggacagcggaacatcctcatcaccagt
gccttgccctatgtgaacaacgtccctcacctgggaaacattgtgggatccgtcctgagt
gccgatgtctttgctagataccataaagcttgcggcagaccaacgctgtacgtttgcgga
acagacgaatatggcacagcaaccgaaaccaaagcgctcgaggagggcgtgacccccgaa
cagttgtgcgccaaatacaacaagatccatcaagaagtttacgaatggtttgggataggc
tttgacatattcgggcgcactccgacgcagaagcataccgagatttcacagaggatattc
aagaggctttatgacaatgggtttttggaggagaagaccgccgagcagccatattgcgaa
aagcacgagtcgtttctggcagatcgatatgtggaaggggagtgtcctcgatgccattat
gatgatgctagaggagaccagtgtgataaatgcggcaacttgctggacccttttgatttg
ataaaccctcgctgcaaagtcgatggcgcaacgccagtcagccggcctacgaaacatatt
catcttcttttagataaacttcaacctcaaatcgaggaatgggtgcgtcctgctattgaa
aagggagactggccgaaaaacagccgtgtgatcacagagtcatggttaaaggagggtctt
aaagatcgcggcatcacacgagacttgaaatggggtgtaccagttccgctcgaaggctac
gagaacaaggtgctttacgtgtggtttgaagcttgcattggatatccttctataacggct
aactacaccgatgattgggaactctggtggagaagtccagaggacgttcagttataccag
tttctcggcaaggataatgtaccgttccatgctgtgatcttcccgggctgtcaattggga
acaaaggataagtggaccatgctacaccatcttagcactaccgaatatctaaattatgag
agcggaaaatttagcaagtctcgtggtatcggcgtttttggaaacaatgcaaaggatact
ggtatcccggcagatgtatggagatattaccttctcaaaaacaggccagaaacgggtgat
acccaattcgaatggcgttctttcattgatgccaacaacggagaactccttgctaaactg
ggcaatctggtaaatcgagttgtcaaactgatagccagccccaaagcctatagcggtgtt
gtccctgatttcacagtccaggaatcgttcaacccagttttggacgatatcacaaccatt
cttcgacaatacatcgaagaaatggagaccgtccatctccgcgccggcctcgccacggcc
atgcgagttgccgaggcaggcaacaacctcattcaatccaacaaactcgacaattccctg
atcgccaacgaacccgaacgcgccgccactgtggtcggaatagtgatcaacttgattcac
ctttgcgccagcgtcttttctccataccttcctgccacctcaaaatccattctcgaacaa
ctcgacgctccattcgcaaatatcccctcattagaagatctcaaagatggctggaaaccc
acagcgatcaaggggggccacaagatcggcaaagcgaaatacctcttctcaaccatcgac
gtcaaaaaggccgatgaatggcgcgccatgtttggcggctcgcaggcagaaaggcagaag
aaagaggaagaagctgctaaactagcagcgaagaaggcggcgaacaaggcgaagaagaag
gaaaagaagaagcagcccaagggagagacggaaggtgaagatacgggaaagagcgtggaa
gcttctgcaaagggcggcgcagaggctgtttctgcgacggtggagggcgggaaggatgag
gctgttgagaagattgcggacggtgttgcgcaagtaaccattccaacatcttag

DBGET integrated database retrieval system