KEGG   Uncinocarpus reesii: UREG_06390Help
Entry
UREG_06390        CDS       T01132                                 

Definition
(RefSeq) cell division control protein 3
  KO
K16944  septin 7
Organism
ure  Uncinocarpus reesii
Brite
KEGG Orthology (KO) [BR:ure00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ure04131]
    UREG_06390
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ure04812]
    UREG_06390
   04147 Exosome [BR:ure04147]
    UREG_06390
Membrane trafficking [BR:ure04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    UREG_06390
Cytoskeleton proteins [BR:ure04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     UREG_06390
Exosome [BR:ure04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UREG_06390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU ABC_tran AAA_16 AIG1 Roc AAA_22 RsgA_GTPase Ras AAA_29 AAA_24 Dynamin_N FtsK_SpoIIIE Sigma54_activat AAA_7 RNA_helicase Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 8442819
NCBI-ProteinID: XP_002583423
UniProt: C4JXL7
AA seq 406 aa AA seqDB search
MRNVVRRKLTGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLGKSTLVNTLFNTSLYPP
RERKGPSLDIIPKTVSIQSISADIEENGVRLRLTVVDTPGFGDFVNNDDSWRPIVENIEQ
RFDAYLDAENKVNRMNIVDNRVHACVYFIQPTGHSLKPLDIEVMRRLHTKVNLIPVIAKA
DTLTDEEVALFKQRILADIHHHNIQIFEGPRYELDDEETLAENQEIMSKVPFAVVGANTE
VTTSNGHKVRGRRYPWGIIEVDNEEHCDFVKLRQMLIRTHMEELKEHTNNVLYENYRSDK
LTAMGVTQDPSVFKEVNPAVKQEEERALHEQKLAKMEAEMKMVFQQKVQEKESKLKQSED
ELYARHREMKEQLDRQRLELEDKKTRLESGRPLEDKIKRKGFSLRN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatgttgttcgccgcaagttgaccggctatgtgggcttcgccaacctgccaaac
cagtggcaccgcaagagtgtccgcaagggattcaattttaatgttatggttgtcggcgag
tctggattgggaaagtcgactttagtgaacactttgttcaatacctccctataccctccc
agagagcgcaagggacccagtctcgatatcatccccaaaactgtctccattcaatccatt
agcgccgatattgaagagaacggcgttcgtctacggttgaccgttgtcgatacaccaggc
tttggcgatttcgttaacaacgatgattcctggcgtccaattgtcgaaaacatcgaacag
cgatttgatgcttacctcgacgcagaaaataaggtcaaccgtatgaacatcgtcgataac
cgcgtccacgcctgcgtgtactttatccaacccaccggccactcattgaagccccttgac
atcgaggtcatgcgccgcctacacaccaaggtcaacttgattccagtcatcgccaaggcg
gataccttgactgatgaagaagttgctcttttcaagcagagaattcttgccgatatccac
catcacaacatccagatcttcgaaggcccccgttatgaactcgatgacgaagaaaccctt
gctgagaaccaggagatcatgtccaaggtccctttcgctgtcgtcggcgcaaacacagaa
gtcactacctccaatggccacaaggtgagaggccgccgctacccatggggtatcatcgaa
gtagacaacgaggagcactgcgactttgtgaaactgcgacaaatgcttatccgcacccac
atggaagagctcaaggagcacaccaacaatgtcttgtacgagaactaccgatccgacaaa
ctcacagctatgggtgtgacacaagaccccagcgtgttcaaggaggtcaatcccgctgtg
aaacaggaagaggaacgcgctcttcacgaacagaagcttgccaagatggaggcagaaatg
aagatggtgttccaacagaaagtgcaagaaaaggagagcaaattaaaacagagcgaggac
gaattatatgctcggcatcgcgaaatgaaagaacaactggaccggcagcgtctcgagttg
gaagacaagaagacccgcctcgaaagtggacgaccgctcgaagacaagataaagcgaaaa
gggttttcacttcgaaattag

DBGET integrated database retrieval system