KEGG   Uncinocarpus reesii: UREG_06619Help
Entry
UREG_06619        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ure  Uncinocarpus reesii
Pathway
ure00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UREG_06619
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     UREG_06619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 8438448
NCBI-ProteinID: XP_002583652
UniProt: C4JVM7
AA seq 327 aa AA seqDB search
MFARFMFRTCRPAGQAVRKYASEASPKPSSNAPLYGGLALAAGGAYYYWQRQQSDAPKPL
EVVRKERPNVFVGGDQGWVDLRLVDIQMLSHNVKKFRFEFPDPEAVSGLHIASALLTKYK
GPKDEKPTIRPYTPVSEEGQPGYLELVIKRYPNGPMSNHLHNMAVGQQLSFKGPIPKYPW
ERNKHDHICMIAGGTGITPMYQIIRKIFNDPEDKTKVTLVFGNVTEEDILLKNEFELLEN
TYPRRFRAFYLLDNPPADWTQGTGYVSKELLKTVLPEPKTENIKIFVCGPPGMYKTVSGP
KTSPKDQGELTGLLKELGYSKDQVYKF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcgatttatgttccggacctgtaggcccgcaggccaggccgttcgcaaatac
gcttccgaagcctcaccaaagccatcgtccaacgccccattgtacggcggcctggctctt
gcggctggaggcgcttactattattggcaacgccaacaatctgatgcgccgaaacctttg
gaggttgtgcgcaaggaacgtccaaatgttttcgtcggtggtgatcaaggctgggtcgac
ctgagacttgtcgacatccaaatgcttagccacaatgttaagaagtttcgcttcgaattt
ccagatccagaggcagtatcgggattgcatatcgcttctgctctgttgaccaaatacaag
ggtccaaaggatgagaagccaactattcgcccctatacgccagtcagtgaagaagggcaa
cccgggtacttggagctcgttatcaagcggtatcctaatggccctatgtccaaccattta
cacaacatggccgtcggccaacagctctccttcaaagggcccattcccaaatacccttgg
gaaagaaacaagcatgatcatatctgcatgattgccggcggcacaggtatcacgccaatg
taccagatcatccgtaaaatcttcaacgaccccgaggacaaaacgaaagtgacacttgtc
tttggtaacgtcaccgaagaggatatcttgctaaagaacgaattcgaattgctagaaaac
acctatccccggcggttccgcgcattctatctccttgacaaccccccggcagattggaca
cagggtaccggctatgttagcaaagagctgctgaagactgtgctgccggagccgaagact
gaaaatatcaagatctttgtttgcggacctcctgggatgtataagactgtcagcggtccg
aagacaagtccaaaggaccagggcgagcttaccggccttttgaaagagcttggatacagc
aaggaccaagtctacaaattttag

DBGET integrated database retrieval system