KEGG   Uncinocarpus reesii: UREG_06994Help
Entry
UREG_06994        CDS       T01132                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ure  Uncinocarpus reesii
Pathway
ure00020  Citrate cycle (TCA cycle)
ure00310  Lysine degradation
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
ure01200  Carbon metabolism
Module
ure_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ure_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UREG_06994
  Amino acid metabolism
   00310 Lysine degradation
    UREG_06994
Enzymes [BR:ure01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     UREG_06994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_3 DUF3614 GCV_H Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 8442534
NCBI-ProteinID: XP_002584027
UniProt: C4JWQ2
AA seq 341 aa AA seqDB search
MAESISEGTLKQFSKQVGDFVERDEELATIETDKIDITVNAPESGIIKEFLAKEDDTVIV
GQDLIKVEPSTEKPAAQKEKPDETTEPAKPKAAKTQPKEQVEDVKPAHPSQRKSDVKEKD
AAPKNGQPAKDAPAPQPISTSHRNLGNRDERRVKMNRMRLRIAERLKQSQNTAASLTTFN
EVDMSSLMELRKLYKEDILKTRGVKLGFMSAFAHACVLAMKEVPAVNASIEGPNGGDTIV
YRDYVDISVAVATEKGLVTPVVRNVETMDLISIEKAIADLGQKARDNKLTIEDMAGGTFT
ISNMMYLALTYDHRLLDGREAVTFLVKVKEFIEDPRRMLLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtctatatcagaaggcaccttgaaacagttctcaaaacaggtcggggatttt
gtggagagggatgaggagctagcaacgatcgaaactgataagatcgatatcactgtgaat
gcgccagagtctgggataatcaaagaattcctggcaaaggaggacgatacagtgatcgta
gggcaagacctaatcaaagtggagccatcaacagaaaaaccagccgcccagaaggaaaag
ccggatgaaaccacagaacctgccaaaccaaaagcagcgaagactcaaccgaaagaacaa
gtggaagatgtaaagccggcccacccaagtcaacggaagtctgatgtgaaagaaaaagac
gccgcgcccaaaaatggacagcctgccaaagacgcccctgcaccccagccaataagtacc
agtcataggaaccttggaaacagagatgagcgtagggtaaagatgaaccgcatgcgacta
cgcattgcggaacgtctaaagcaatctcagaatacggcggcttcgctaacaactttcaat
gaagttgatatgtcgtcactcatggagttacgcaaattatataaagaagatattctaaaa
acgaggggtgtcaaacttggattcatgagcgcatttgctcacgcatgtgtgttggcaatg
aaagaggtcccagccgtcaatgcctcgattgaagggccaaacggaggtgatactattgta
taccgagattatgtcgacatcagcgttgcagttgcaacagagaaaggactcgtgacccct
gtggtgcgcaatgtagagaccatggatctcatttcgatcgaaaaggcaatcgcagatctt
ggacaaaaggctcgagacaataagctaacaatcgaagacatggctggtggcacattcacg
atcagtaatatgatgtatctagctttgacctatgatcatcgcctccttgacgggagagaa
gccgtcaccttcttagttaaggtcaaggagttcatcgaagacccaaggcgcatgttgcta
gcgtaa

DBGET integrated database retrieval system