KEGG   Uncinocarpus reesii: UREG_07400Help
Entry
UREG_07400        CDS       T01132                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
ure  Uncinocarpus reesii
Pathway
ure00072  Synthesis and degradation of ketone bodies
ure00280  Valine, leucine and isoleucine degradation
ure00650  Butanoate metabolism
ure00900  Terpenoid backbone biosynthesis
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
Module
ure_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UREG_07400
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    UREG_07400
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UREG_07400
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UREG_07400
Enzymes [BR:ure01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     UREG_07400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_N HMG_CoA_synt_C
Motif
Other DBs
NCBI-GeneID: 8440001
NCBI-ProteinID: XP_002582627
UniProt: C4JYZ9
AA seq 446 aa AA seqDB search
MSSRPQNIGIKALEVYFPSQCVDQAELEKFDGVSQGKYTIGLGQTKMSFCDDREDIYSMA
LTTLSSLLRKYNIDPTSIGRLEVGTETILDKSKSVKSVLMQLFAPAGNTNVEGVDTVNAC
YGGTNALFNSINWVESSAWDGRDAIVVTGDIALYKKGNARPTGGAGCVAMLIGPNAPMVI
ESGLRGSYITHAYDFYKPDLTSEYPYVDGHFSIKCYTQAVDACYKAYNAREKALSPAQNG
EISTDESKTPLDRFDHILFHAPTCKLVSKSYGRLLYNDYLANPSHPAFAEVPAEILDLDY
DKSLSDKTVEKTFMALTKKRFAEKVQPSIQVATLCGNMYCASVYGGLVSLLSNVAFDATK
PKRVGVFSYGSGLASSMFSLKIVGDVSNIVEKLDLQKRLDARRVVSPQVFDDMCLLREKA
HLKKDFTSYWQPRGPIPRNLLPYQSR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcgtccccagaacatcggaatcaaggcccttgaggtctattttccaagccaa
tgcgtcgaccaagccgagctcgaaaagttcgatggcgttagccaggggaagtacaccatt
ggcctgggccaaaccaaaatgagcttctgtgacgatagagaagatatctactcgatggcc
cttacaactctttcctcacttctacgcaagtacaacattgatccaacgtccatcggtcgc
ctcgaagtaggcacggaaaccattcttgacaaatccaagtctgtgaaatcagtcttaatg
cagttgtttgctccggctggaaatacaaacgtcgagggtgttgataccgtgaatgcttgc
tatggtggcactaatgccctcttcaactctatcaattgggttgaatcttctgcatgggac
ggaagagacgctattgtcgttacaggagacattgcgctctacaagaaaggcaatgcccgt
cccactggcggagccggctgtgttgctatgctcatcggccccaacgccccaatggttatc
gagagcggactacgaggcagttacatcacccatgcttacgatttttacaagccagactta
accagtgaatacccatatgtcgatggccatttttctattaaatgttatacccaagccgtc
gatgcttgctataaagcatacaatgctagagagaaggctctgagccctgcgcaaaatggc
gaaatctccaccgacgaatcgaaaactcctcttgaccgttttgaccacatccttttccat
gcgccgacttgcaagcttgtctccaagtcctatgggcgcctactttacaatgattacctc
gccaacccgagccacccggcttttgcagaagttcccgctgaaattctcgatcttgattac
gataaatctctctctgataaaacggttgagaaaaccttcatggcgcttactaagaagcgc
tttgctgagaaagttcagccatctatccaggttgccaccttgtgtggtaacatgtactgt
gcgagtgtttatggaggtttggttagtttgttgtccaacgttgctttcgatgctacgaag
ccgaagcgcgtcggcgtttttagctatggaagtggtttggctagctccatgtttagcttg
aagatcgttggcgatgtttccaatattgttgagaagctcgacctgcaaaagcgtctggat
gctagacgagttgtctcaccacaggttttcgacgatatgtgtctcttgcgtgagaaggcg
cacttgaaaaaggatttcacttcctattggcagccccgaggacctattcccaggaactta
ttaccttaccaaagtcgatga

DBGET integrated database retrieval system