KEGG   Uncinocarpus reesii: UREG_07670Help
Entry
UREG_07670        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     UREG_07670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Acid_phosphat_B
Motif
Other DBs
NCBI-GeneID: 8439686
NCBI-ProteinID: XP_002582897
UniProt: C4JZR9
AA seq 305 aa AA seqDB search
MAPKYLTGDSQAINDFLDRFDVFLFDCDGVLWSGDIVFDGTVETLEMLRNKGKQVVFVTN
NSTKSRLDYKKKLDKLGIPATREEVFSSSFSAAVYISRILNLPPNKRKVFVLGETGIEQE
LQAENIPFIGATDPAYRRDVSAEDYNKIAAGDPSLLDPEVGAVLVGLDFHINYLKISLAY
HYIRRGALFLATNIDSTLPNAGTLFPGAGTISAPLIRMLGGTEPISLGKPSPEMMVAVEG
KFKFNRQRACMVGDRLDTDIRFGIEGGLGGTLGVLTGVSSKDDFEAATLPPMAYVDKLGD
LLGGA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaaagtacctgactggtgacagccaggcgatcaatgattttcttgatcggttc
gatgtatttctgtttgactgcgatggcgtgttatggtccggggatatcgtctttgatgga
actgtcgaaactttggaaatgctgagaaacaaagggaagcaggtcgtcttcgtaaccaac
aatagcaccaagtcacgacttgattacaagaagaaactggacaaacttggaattcccgct
actcgcgaggaagtattttcctcctctttcagcgcagccgtttatatctccaggatcttg
aacctacctccgaacaaacgcaaggtgttcgtcctcggagagaccggcatcgagcaagaa
ctccaagctgagaatatcccatttattggcgccacagatccggcctaccgtcgcgacgtt
tccgctgaagactacaacaagatcgccgccggcgacccttctcttctcgacccagaggtc
ggcgccgtcctcgtcggcctagacttccacatcaactacctcaaaatatcccttgcatat
cactatatccggcgcggcgcacttttcctcgccaccaatatcgatagcacgcttcccaat
gctgggaccctgttccccggcgcaggcaccataagtgcgccattgatccggatgctcggg
ggcacggagccgatatccctcggaaagccgagcccagagatgatggtggctgttgagggg
aagttcaagttcaatcgacaacgagcgtgcatggtgggtgaccggttggatacggatatt
agattcgggatcgaaggaggactaggcggaacgctgggagttttgaccggcgtgagttcc
aaagatgactttgaggctgcgacgcttccaccaatggcgtatgtggataagttgggagat
ttgcttgggggtgcatag

DBGET integrated database retrieval system