KEGG   Ureaplasma urealyticum: UUR10_0172Help
Entry
UUR10_0172        CDS       T00781                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
uue  Ureaplasma urealyticum
Pathway
uue00010  Glycolysis / Gluconeogenesis
uue00051  Fructose and mannose metabolism
uue01100  Metabolic pathways
uue01110  Biosynthesis of secondary metabolites
uue01120  Microbial metabolism in diverse environments
uue01130  Biosynthesis of antibiotics
uue01200  Carbon metabolism
uue01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:uue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UUR10_0172 (tpiA)
   00051 Fructose and mannose metabolism
    UUR10_0172 (tpiA)
   00562 Inositol phosphate metabolism
    UUR10_0172 (tpiA)
Enzymes [BR:uue01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UUR10_0172 (tpiA)
Exosome [BR:uue04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UUR10_0172 (tpiA)
  Exosomal proteins of bladder cancer cells
   UUR10_0172 (tpiA)
  Exosomal proteins of melanoma cells
   UUR10_0172 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACI59792
UniProt: B5ZAY7
Position
202180..202905
Genome map
AA seq 241 aa AA seqDB search
MVKMKYIIANFKMNATEELINHFLNNLISFDEQKLTIGLAPGDLYLKTFVDLSQTKKVKL
YAQNPSAYSKGPYTGQISCLQLLDSNIKNTLVGHSEIRIDCSQSIIDQKTKICMDLLDQV
IICIGEPLDVYEQKKSLSFVLSQLANVINYKGLKKIIIAYEPIWAIGTNLTLDLKHINHM
IEGIKTYLYNCTGLNIPILYGGSVNANNIKELCTQKLIDGFLIGNASLDVNNFNQIINAC
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaatgaaatacattattgctaattttaaaatgaatgcaaccgaagaattaatt
aatcattttttaaacaacttgatatcatttgatgaacaaaaattaacgattggtttagca
ccaggcgatttatatttaaaaacatttgttgatttatcgcaaactaaaaaagttaaatta
tatgctcaaaatccatcagcttattctaaaggaccttatactggtcaaataagttgttta
caattattagattctaatatcaaaaatactttagttggtcatagtgagattcgtattgat
tgctcgcaatcaataattgatcaaaaaacaaaaatttgcatggatttattagatcaagta
attatttgtattggtgaaccactcgatgtttatgaacaaaaaaaatcccttagtttcgtt
ttaagtcaattagctaatgttattaactataagggattgaaaaaaattattattgcttat
gaaccaatttgagcaattggtactaatttaacacttgatttaaaacatattaatcacatg
atagaaggcattaaaacatatttatacaattgtactggattaaatattcctattttatat
gggggtagtgttaatgctaataatattaaagaattgtgtacacaaaaactaattgatgga
tttttaattggtaatgcttcattagatgttaataattttaatcaaattattaatgcttgc
aaataa

DBGET integrated database retrieval system